DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and Cetn4

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001258080.1 Gene:Cetn4 / 688611 RGDID:1586489 Length:168 Species:Rattus norvegicus


Alignment Length:163 Identity:104/163 - (63%)
Similarity:135/163 - (82%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMIS 84
            |.|....||...|.||::.||.:|||||||||.:|:|.|::||||:|:|||||||||||:|::|:
  Rat     6 RTTLDQWKKKAAKVELNDTQKQEIKEAFDLFDIDGSGTIDLKELKIAMRALGFEPKKEEVKQLIT 70

  Fly    85 DIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTD 149
            :|||:.:|.|.|..|..:|:|||:|||.||||||||:|||||.||.||..|:||||:||||.||:
  Rat    71 EIDKEGTGTICFEDFFAIMSIKMSEKDEKEEILKAFKLFDDDATGSISLNNIKRVAKELGENLTE 135

  Fly   150 EELREMIDEADLDNDGEVNQEEFLRIMKKTSLY 182
            :||:||:||||.|.|||:|:||||::|:|||||
  Rat   136 DELQEMLDEADRDGDGEINEEEFLKMMRKTSLY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 100/155 (65%)
EFh 42..104 CDD:238008 37/61 (61%)
EFh 115..177 CDD:238008 43/61 (70%)
Cetn4NP_001258080.1 PTZ00183 13..168 CDD:185503 100/154 (65%)
EFh 28..90 CDD:238008 37/61 (61%)
EFh 101..163 CDD:238008 43/61 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.