DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and cetn3

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001018335.1 Gene:cetn3 / 552931 ZFINID:ZDB-GENE-050522-152 Length:167 Species:Danio rerio


Alignment Length:151 Identity:85/151 - (56%)
Similarity:117/151 - (77%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDC 90
            |||   :.||::.||.:|||||:||..:....|:..|||||:||||||.||.::.:::.|.|::.
Zfish    16 RKK---RRELTDEQKDEIKEAFELFGTDKDKEIDYHELKVAMRALGFEVKKVDVLKILKDYDREG 77

  Fly    91 SGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREM 155
            :|:|:|..|.:::|..:.|:|.||||||||:|||||:|||||.|||:||||||||.::||:||.|
Zfish    78 TGKISFEDFREVVTDMILERDPKEEILKAFKLFDDDETGKISLRNLRRVARELGEDMSDEDLRAM 142

  Fly   156 IDEADLDNDGEVNQEEFLRIM 176
            |||.|.|.|||:||:||:.||
Zfish   143 IDEFDTDGDGEINQDEFISIM 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 85/151 (56%)
EFh 42..104 CDD:238008 27/61 (44%)
EFh 115..177 CDD:238008 46/62 (74%)
cetn3NP_001018335.1 PTZ00183 13..167 CDD:185503 85/151 (56%)
EFh 29..91 CDD:238008 27/61 (44%)
EFh 102..164 CDD:238008 46/62 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.