DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and cetn1

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001017149.1 Gene:cetn1 / 549903 XenbaseID:XB-GENE-967617 Length:172 Species:Xenopus tropicalis


Alignment Length:162 Identity:120/162 - (74%)
Similarity:141/162 - (87%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISD 85
            |....|||..||.||:|.||.:|:|||||||.:|.|.|:|||||||:|||||||||||||:||:|
 Frog    11 GVTTQRKKPVPKPELTEEQKQEIREAFDLFDTDGAGTIDVKELKVAMRALGFEPKKEEIKKMIAD 75

  Fly    86 IDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDE 150
            |||:.:|:|:|..|:..||.||||||:||||:|||||||||:||||||:||||||:||||.||||
 Frog    76 IDKEGTGKISFGDFMSAMTQKMAEKDSKEEIMKAFRLFDDDETGKISFKNLKRVAKELGENLTDE 140

  Fly   151 ELREMIDEADLDNDGEVNQEEFLRIMKKTSLY 182
            ||:|||||||.|.|||||::||||||||||||
 Frog   141 ELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 117/155 (75%)
EFh 42..104 CDD:238008 41/61 (67%)
EFh 115..177 CDD:238008 51/61 (84%)
cetn1NP_001017149.1 PTZ00183 16..172 CDD:185503 117/155 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6075
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55798
Inparanoid 1 1.050 239 1.000 Inparanoid score I3272
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - otm47939
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.