DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CG17770

DIOPT Version :10

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster


Alignment Length:145 Identity:50/145 - (34%)
Similarity:89/145 - (61%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVF 99
            |:|.|..|::.||.|||::.|..|.:..|:..:.::...|...|::.:.::||.|.||.:..:.|
  Fly    20 LTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLSDF 84

  Fly   100 LQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDND 164
            |.:|:.:.|...|::||:.|||:||.:.||.||....:.:.:.:||.|||:|:.|:|.:|:.|.:
  Fly    85 LHIMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLE 149

  Fly   165 GEVNQEEFLRIMKKT 179
            |.::...|:|:|..|
  Fly   150 GNIDYVRFVRMMSTT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 50/145 (34%)
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 48/140 (34%)

Return to query results.
Submit another query.