DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CG5024

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster


Alignment Length:145 Identity:44/145 - (30%)
Similarity:86/145 - (59%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVF 99
            |::.|..|.:.||.|||::....|.:|.|:..:||:...|.:.||:..|::||.|.||.:..:.|
  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85

  Fly   100 LQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDND 164
            |.:|:.:......::|::.||::||.|.:|.|.....:::..|.|:.:.::|:.|||.:||.:.:
  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE 150

  Fly   165 GEVNQEEFLRIMKKT 179
            .:::...|:.:|.:|
  Fly   151 LKIDYVRFVTMMMET 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 44/145 (30%)
EFh 42..104 CDD:238008 22/61 (36%)
EFh 115..177 CDD:238008 17/61 (28%)
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 42/141 (30%)
EFh 28..90 CDD:298682 22/61 (36%)
EFh 64..127 CDD:238008 19/62 (31%)
EFh 101..163 CDD:298682 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.