DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and TpnC73F

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster


Alignment Length:146 Identity:50/146 - (34%)
Similarity:88/146 - (60%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNV 98
            :|:..|...:::||:.||::.||.|..:.:...:|.:|....|:.::.:|.::|:|.|||:.|..
  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71

  Fly    99 FLQLMTIKMAEKDT---KEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEAD 160
            |:||....:.|:|.   ::|:.:||||:|....|.|....||.:.:||.:.||::||..||:|.|
  Fly    72 FVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEID 136

  Fly   161 LDNDGEVNQEEFLRIM 176
            .|..|.|:.:||:.:|
  Fly   137 SDGSGTVDFDEFMEMM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 50/146 (34%)
EFh 42..104 CDD:238008 20/61 (33%)
EFh 115..177 CDD:238008 26/62 (42%)
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 50/146 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.