DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CG13526

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster


Alignment Length:149 Identity:35/149 - (23%)
Similarity:84/149 - (56%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PKF---ELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSG 92
            |.|   ||:.....::::||:.:|.:..|.:...|:::|:.::|:|..:.|:..:|..:......
  Fly     2 PSFSGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEE 66

  Fly    93 RIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMID 157
            |:....|:::|..:||..|:.:.:.:.|.:.|.|..|.::.::::.:...|||.:||::::::..
  Fly    67 RLDLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQ 131

  Fly   158 EADLDNDGEVNQEEFLRIM 176
            ..|:|.||.::..:|:..|
  Fly   132 AVDMDGDGRISLRDFVGFM 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 35/149 (23%)
EFh 42..104 CDD:238008 12/61 (20%)
EFh 115..177 CDD:238008 15/62 (24%)
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 33/144 (23%)
EFh 16..78 CDD:238008 12/61 (20%)
EFh 92..151 CDD:238008 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.