DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CG13526

DIOPT Version :10

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster


Alignment Length:149 Identity:35/149 - (23%)
Similarity:84/149 - (56%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PKF---ELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSG 92
            |.|   ||:.....::::||:.:|.:..|.:...|:::|:.::|:|..:.|:..:|..:......
  Fly     2 PSFSGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEE 66

  Fly    93 RIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMID 157
            |:....|:::|..:||..|:.:.:.:.|.:.|.|..|.::.::::.:...|||.:||::::::..
  Fly    67 RLDLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQ 131

  Fly   158 EADLDNDGEVNQEEFLRIM 176
            ..|:|.||.::..:|:..|
  Fly   132 AVDMDGDGRISLRDFVGFM 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 35/149 (23%)
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 33/144 (23%)

Return to query results.
Submit another query.