DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CG9406

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster


Alignment Length:171 Identity:44/171 - (25%)
Similarity:74/171 - (43%) Gaps:30/171 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDK-DCSGRIAFN 97
            ||.|    .|.|||.:||..|..||:.:.:...:|.||..|.::|::.:|...|. |..|.....
  Fly    10 ELEE----KISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKEVEDVIKATDSVDYPGEAHLV 70

  Fly    98 VFLQ----LMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREM--- 155
            .|::    |:..:..|..:.|::|:||...|.::...::.....::..|.||..:.|||..|   
  Fly    71 KFMEHVSKLLMDRQMEPASSEKLLEAFETLDPENKKYLTKEYFGKLMAEEGEPFSAEELDAMWPV 135

  Fly   156 -ID-----------------EADLDNDGEVNQEEFLRIMKK 178
             ||                 :.|:....||.:||..:..|:
  Fly   136 AIDPITGHIPYTFYINQLRHKPDIYEIAEVIKEELAQAEKE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 44/171 (26%)
EFh 42..104 CDD:238008 20/66 (30%)
EFh 115..177 CDD:238008 18/82 (22%)
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 38/149 (26%)
EFh 14..>59 CDD:298682 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.