DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and TpnC41C

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster


Alignment Length:146 Identity:49/146 - (33%)
Similarity:83/146 - (56%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNV 98
            ||::.|...::.||:.||.|..|||....:...:..||.:.....:..:|:::|:|.||:|.|..
  Fly     4 ELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEE 68

  Fly    99 FLQLMTIKMAEKDTK---EEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEAD 160
            |..|....:.|:|.:   .|:.:||||:|.:..|.|:...|:.:.|||.:.||:::|..||:|.|
  Fly    69 FTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEID 133

  Fly   161 LDNDGEVNQEEFLRIM 176
            .|..|.|:.:||:.:|
  Fly   134 SDGSGTVDFDEFMEVM 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 49/146 (34%)
EFh 42..104 CDD:238008 19/61 (31%)
EFh 115..177 CDD:238008 25/62 (40%)
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 49/146 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.