DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CG42750

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_724101.4 Gene:CG42750 / 35090 FlyBaseID:FBgn0261804 Length:1068 Species:Drosophila melanogaster


Alignment Length:59 Identity:14/59 - (23%)
Similarity:28/59 - (47%) Gaps:5/59 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 MTIKMAEKDTKEEILK-AFRLFDD----DDTGKISFRNLKRVARELGETLTDEELREMI 156
            :.:::|.....||.|: |.:|.|.    |....:.:...|.:..:|.:...||:||.::
  Fly   681 LALRVAASAPFEERLRVAVQLLDQVPLIDGHNDLPWNIRKFLHNKLNDFNFDEDLRNVM 739

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 14/59 (24%)