DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and TpnC25D

DIOPT Version :10

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_608915.2 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster


Alignment Length:146 Identity:45/146 - (30%)
Similarity:83/146 - (56%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSEAQKCDI-KEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNV 98
            :.:.:|.|| ::||.:||.:.||:||...||..:.::|......|::.:|.|.|.:.:|::.|:.
  Fly     1 MEDDEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDG 65

  Fly    99 FLQLMTIKMAEKDT---KEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEAD 160
            |..:....:.|:|.   ::|:.:||||:|.:..|.|:...||.:...|.:.|:..:|..:|.|.|
  Fly    66 FCSIAAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEID 130

  Fly   161 LDNDGEVNQEEFLRIM 176
            .|..|.|:.:||:.:|
  Fly   131 TDGSGTVDFDEFMEMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 45/146 (31%)
TpnC25DNP_608915.2 PTZ00184 4..146 CDD:185504 44/141 (31%)

Return to query results.
Submit another query.