DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CG11638

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster


Alignment Length:150 Identity:53/150 - (35%)
Similarity:90/150 - (60%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVF 99
            :|:.|..:.:|||.|||.:|.|.|..:||...:|:||...:.||::.|:.:||.|..|.::|..|
  Fly   206 ISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEF 270

  Fly   100 LQL---MTIK----MAEKDTKE-EILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMI 156
            :.:   ||.:    ::..|.:| |:..|||:||..:.|.|:..:|:.|.:.|||.|.:|::.:||
  Fly   271 VDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMI 335

  Fly   157 DEADLDNDGEVNQEEFLRIM 176
            .|.|:|.||.::..||:..:
  Fly   336 KEVDVDGDGRIDFYEFVHAL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 53/149 (36%)
EFh 42..104 CDD:238008 23/64 (36%)
EFh 115..177 CDD:238008 24/61 (39%)
CG11638NP_569879.1 EFh 213..275 CDD:238008 23/61 (38%)
EF-hand_7 215..274 CDD:290234 23/58 (40%)
EFh 294..355 CDD:238008 24/60 (40%)
EF-hand_7 295..355 CDD:290234 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.