DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and Cetn2

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_062278.2 Gene:Cetn2 / 26370 MGIID:1347085 Length:172 Species:Mus musculus


Alignment Length:157 Identity:118/157 - (75%)
Similarity:142/157 - (90%) Gaps:0/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDC 90
            ||:..||.||:|.||.:|:|||||||.:|||.|::||||||:|||||||||||||:|||:|||:.
Mouse    16 RKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRALGFEPKKEEIKKMISEIDKEG 80

  Fly    91 SGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREM 155
            :|::.|:.||.:||.||:||||||||||||:|||||:||||||:||||||:||||.||||||:||
Mouse    81 TGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEM 145

  Fly   156 IDEADLDNDGEVNQEEFLRIMKKTSLY 182
            |||||.|.|||||::||||||||||||
Mouse   146 IDEADRDGDGEVNEQEFLRIMKKTSLY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 116/155 (75%)
EFh 42..104 CDD:238008 41/61 (67%)
EFh 115..177 CDD:238008 51/61 (84%)
Cetn2NP_062278.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 8/14 (57%)
Required for self-assembly. /evidence=ECO:0000250 2..25 4/8 (50%)
PTZ00183 16..172 CDD:185503 116/155 (75%)
EFh 32..94 CDD:238008 41/61 (67%)
EFh 105..167 CDD:238008 51/61 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6064
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55798
Inparanoid 1 1.050 242 1.000 Inparanoid score I3304
Isobase 1 0.950 - 0 Normalized mean entropy S400
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - otm42827
orthoMCL 1 0.900 - - OOG6_101416
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.