DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and Cetn4

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_665824.1 Gene:Cetn4 / 207175 MGIID:2677454 Length:168 Species:Mus musculus


Alignment Length:165 Identity:104/165 - (63%)
Similarity:137/165 - (83%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AKRGTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRM 82
            ::|.|....||...|.||::.||.:|||||||||.:|:|.|::||||:|:|||||||||||:|::
Mouse     4 SQRITLDQWKKKAAKVELNDTQKQEIKEAFDLFDIDGSGTIDLKELKIAMRALGFEPKKEEVKQL 68

  Fly    83 ISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETL 147
            |::|||:.:|.|.|..|..:|::||:|||.||||||||:|||||.||.||..|:||||:||||.|
Mouse    69 IAEIDKEGTGTICFEDFFAIMSVKMSEKDEKEEILKAFKLFDDDATGSISLNNIKRVAKELGENL 133

  Fly   148 TDEELREMIDEADLDNDGEVNQEEFLRIMKKTSLY 182
            |::||:||:||||.|.|||:|:||||::|||||||
Mouse   134 TEDELQEMLDEADRDGDGEINEEEFLKMMKKTSLY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 100/155 (65%)
EFh 42..104 CDD:238008 37/61 (61%)
EFh 115..177 CDD:238008 43/61 (70%)
Cetn4NP_665824.1 EFh_PEF 13..168 CDD:330173 100/154 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7579
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.