DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and cal-8

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_495043.1 Gene:cal-8 / 184373 WormBaseID:WBGene00017394 Length:145 Species:Caenorhabditis elegans


Alignment Length:143 Identity:50/143 - (34%)
Similarity:83/143 - (58%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVF 99
            :...::.:|:|.|..||..|.|.|..:||:||:..||.:....:|:.||...|.|.:|.|..:.|
 Worm     1 MDSLKEAEIREVFREFDKNGDGRITRQELEVALLQLGEKASNSKIETMIEQADLDGNGCIDIDEF 65

  Fly   100 LQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDND 164
            |.::..::.:...:.|:...|.:||.:..|.||..:|..|..:|||.||:.|.:|||.:.|||:|
 Worm    66 LNVLRRQICDPKEERELRDVFNVFDKNGDGVISIDDLIFVMCQLGEKLTETEAKEMIKQGDLDHD 130

  Fly   165 GEVNQEEFLRIMK 177
            |.::.:||:.|:|
 Worm   131 GMIDFQEFVNIIK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 50/143 (35%)
EFh 42..104 CDD:238008 23/61 (38%)
EFh 115..177 CDD:238008 26/61 (43%)
cal-8NP_495043.1 PTZ00184 7..142 CDD:185504 48/134 (36%)
EFh 8..70 CDD:238008 23/61 (38%)
EFh 81..143 CDD:238008 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.