DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and B0563.7

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_509544.1 Gene:B0563.7 / 182041 WormBaseID:WBGene00015264 Length:229 Species:Caenorhabditis elegans


Alignment Length:168 Identity:52/168 - (30%)
Similarity:92/168 - (54%) Gaps:13/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AKRGTQQGRKKSGPKFELSEAQKCDIKE---AFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEI 79
            :.|||...::......::...:| ::||   .|::||.:|:|.|..:|||.|:.::|....|.||
 Worm    26 SSRGTIHSQQSQPEDIQMKYTRK-ELKEYRQLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEI 89

  Fly    80 KRMISDIDKDCSGRIAFNVFLQLMTIKMAE---KDTKEEILK-AFRLFDDDDTGKISFRNLKRVA 140
            ..:|.::|.|.:|.|.|..|...|  |.::   |.|.||::: .|.:||.|..|.|:....|.:|
 Worm    90 DNVIKEVDADGNGEIDFEEFCACM--KKSQNIVKSTNEELIRECFEIFDQDRNGIITENEFKYIA 152

  Fly   141 RELGETLTDEELREMI-DEADLDNDGEVNQEEFLRIMK 177
            :|.|:  .|:||.|.: .|.|:..:|.::.::|..|::
 Worm   153 KEFGD--FDDELAEKVFRELDVSANGHLSADQFATIVE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 49/160 (31%)
EFh 42..104 CDD:238008 23/64 (36%)
EFh 115..177 CDD:238008 20/63 (32%)
B0563.7NP_509544.1 PTZ00184 46..183 CDD:185504 47/141 (33%)
EFh 52..114 CDD:238008 23/63 (37%)
EFh 88..153 CDD:238008 22/66 (33%)
EFh 128..187 CDD:238008 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.