DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and mlc-1

DIOPT Version :10

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_510829.2 Gene:mlc-1 / 181776 WormBaseID:WBGene00003369 Length:170 Species:Caenorhabditis elegans


Alignment Length:162 Identity:51/162 - (31%)
Similarity:78/162 - (48%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TQQGRKKSGPKFELSEAQKCD------IKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIK 80
            ::..:|||..|...|||.:.|      .||||.:.|....|.|:..:||....::|......:|.
 Worm     2 SKAAKKKSSKKRSGSEAAQFDQKTIQEFKEAFGIMDQNKDGIIDKSDLKDLYASMGQIAPDSQID 66

  Fly    81 RMISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNL-KRVARELG 144
            .||    |:.||.|.|.|||.|...::...|.:..|:.||.:||..|.|||...:| |.:..:.|
 Worm    67 AMI----KEASGPINFTVFLTLFGERLTGTDPEATIIGAFAMFDKKDCGKIKEDDLIKILQNKRG 127

  Fly   145 ETLTDEELREMIDEADLDNDGEVNQEEFLRIM 176
            |.|.::|::.|.........|||:.:.|..::
 Worm   128 EPLDEDEVKAMYKGKPPIEGGEVDYKAFAHLI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 51/158 (32%)
mlc-1NP_510829.2 PTZ00184 18..160 CDD:185504 45/146 (31%)

Return to query results.
Submit another query.