DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and E02A10.3

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001343832.1 Gene:E02A10.3 / 179722 WormBaseID:WBGene00008453 Length:283 Species:Caenorhabditis elegans


Alignment Length:143 Identity:42/143 - (29%)
Similarity:89/143 - (62%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVFL 100
            ||.:..:.::.|::||.:.:|.|.:.||:.||:.||.|..::|:.::|.::|:..:.:|.|:.|.
 Worm   132 SEEELQEYRQVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFDEFC 196

  Fly   101 QLM-TIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDND 164
            .:| .:.|.:.:..|.:.:.|.:||..:.|.||.::.:.:.||||:...::.:.|:.:|||:|.:
 Worm   197 VVMRRLTMKKSNWNEVVKECFTVFDRSENGGISKKDFRFILRELGDITDNQIIDEIFNEADVDGN 261

  Fly   165 GEVNQEEFLRIMK 177
            |.::.:||..::|
 Worm   262 GVIDYDEFTYMVK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 42/143 (29%)
EFh 42..104 CDD:238008 19/62 (31%)
EFh 115..177 CDD:238008 18/61 (30%)
E02A10.3NP_001343832.1 EFh_PEF 132..273 CDD:330173 41/140 (29%)
EF-hand motif 140..167 CDD:320054 9/26 (35%)
EF-hand motif 175..203 CDD:320054 6/27 (22%)
EF-hand motif 208..241 CDD:320054 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157744
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.