DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and cal-3

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_500421.2 Gene:cal-3 / 177143 WormBaseID:WBGene00000287 Length:234 Species:Caenorhabditis elegans


Alignment Length:142 Identity:56/142 - (39%)
Similarity:88/142 - (61%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNV 98
            :|:|.:..:.||||.|||.:|.|.|.:|||.||:||||..|.::::..:|.|:|.|.:|::.|..
 Worm    92 QLTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHDVDLDGNGQVEFPE 156

  Fly    99 FLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDN 163
            |..:|...|.|.|: |.|.:||::||.|..|.|:....|.....:|....:.|:.||::|.|.|.
 Worm   157 FCVMMKRIMKETDS-EMIREAFKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVDCDG 220

  Fly   164 DGEVNQEEFLRI 175
            :||::.|||::|
 Worm   221 NGEIDYEEFVKI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 56/142 (39%)
EFh 42..104 CDD:238008 27/61 (44%)
EFh 115..177 CDD:238008 22/61 (36%)
cal-3NP_500421.2 PTZ00184 92..232 CDD:185504 55/140 (39%)
EFh 100..162 CDD:238008 27/61 (44%)
EFh 172..234 CDD:238008 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157772
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.