DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and Cetn3

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_038957534.1 Gene:Cetn3 / 170895 RGDID:620249 Length:190 Species:Rattus norvegicus


Alignment Length:180 Identity:94/180 - (52%)
Similarity:128/180 - (71%) Gaps:12/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NSTAAGN---ANPATVPAKRG----TQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVK 61
            |..|.||   ::|.|  :.||    .:..|||   :.||||.||.:||:||:|||.:....|:..
  Rat    12 NGPAVGNFGQSHPET--SVRGELVVDKTKRKK---RRELSEEQKQEIKDAFELFDTDKDQAIDYH 71

  Fly    62 ELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDD 126
            |||||:|||||:.||.::.:::.|.|::.:|:|.|..|.:::|..:.|:|..|||||||:|||||
  Rat    72 ELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDD 136

  Fly   127 DTGKISFRNLKRVARELGETLTDEELREMIDEADLDNDGEVNQEEFLRIM 176
            |:||||.|||:||||||||.::|||||.||:|.|.|.|||:|||||:.||
  Rat   137 DSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIM 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 86/151 (57%)
EFh 42..104 CDD:238008 26/61 (43%)
EFh 115..177 CDD:238008 47/62 (76%)
Cetn3XP_038957534.1 PTZ00183 38..189 CDD:185503 86/152 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.