DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and cetn4

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_012810447.1 Gene:cetn4 / 100144661 XenbaseID:XB-GENE-920656 Length:171 Species:Xenopus tropicalis


Alignment Length:165 Identity:118/165 - (71%)
Similarity:141/165 - (85%) Gaps:2/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PAKRGTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKR 81
            |....||  |::.|.|.||:|.||.:|:|||||||.:|:|.|:|||||||:|||||||||||:|:
 Frog     8 PGLGATQ--RRRIGAKPELTEEQKQEIREAFDLFDTDGSGTIDVKELKVAMRALGFEPKKEEMKK 70

  Fly    82 MISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGET 146
            :|||.|||.||.|.|..||.|||.||:|||:||||:|||||||||:||||||:||||||:||||.
 Frog    71 IISDTDKDGSGIIDFEDFLSLMTQKMSEKDSKEEIMKAFRLFDDDNTGKISFKNLKRVAKELGEN 135

  Fly   147 LTDEELREMIDEADLDNDGEVNQEEFLRIMKKTSL 181
            ||||||:|||||||.|.|||:|::||||||:||||
 Frog   136 LTDEELQEMIDEADRDGDGEINEQEFLRIMRKTSL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 115/156 (74%)
EFh 42..104 CDD:238008 43/61 (70%)
EFh 115..177 CDD:238008 50/61 (82%)
cetn4XP_012810447.1 PTZ00183 15..170 CDD:185503 113/154 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6075
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I3272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - otm47939
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.