DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and cetn2

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_001345066.1 Gene:cetn2 / 100006257 ZFINID:ZDB-GENE-091118-94 Length:172 Species:Danio rerio


Alignment Length:172 Identity:128/172 - (74%)
Similarity:150/172 - (87%) Gaps:4/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ATVPAKR---GTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPK 75
            ||.| ||   |....|||:.||.||:|.||.:|:|||:|||.:|:|||||||||||:||||||||
Zfish     2 ATSP-KRPSLGAVAPRKKASPKSELTEEQKQEIREAFELFDTDGSGYIEVKELKVAMRALGFEPK 65

  Fly    76 KEEIKRMISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVA 140
            |||||:||:::||:.:|:|:|..||.:||.||||||:||||||||||||||:|||||||||||||
Zfish    66 KEEIKKMIAEVDKEATGKISFTDFLSVMTQKMAEKDSKEEILKAFRLFDDDETGKISFRNLKRVA 130

  Fly   141 RELGETLTDEELREMIDEADLDNDGEVNQEEFLRIMKKTSLY 182
            :||||.||||||:|||||||.|.||||||:||||||||||||
Zfish   131 KELGENLTDEELQEMIDEADRDGDGEVNQQEFLRIMKKTSLY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 120/155 (77%)
EFh 42..104 CDD:238008 41/61 (67%)
EFh 115..177 CDD:238008 54/61 (89%)
cetn2XP_001345066.1 PTZ00183 16..172 CDD:185503 120/155 (77%)
EFh 32..94 CDD:238008 41/61 (67%)
EFh 105..167 CDD:238008 54/61 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581755
Domainoid 1 1.000 116 1.000 Domainoid score I5916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55798
Inparanoid 1 1.050 249 1.000 Inparanoid score I3226
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - otm24565
orthoMCL 1 0.900 - - OOG6_101416
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.