DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17490 and rpl5a

DIOPT Version :9

Sequence 1:NP_001036395.2 Gene:CG17490 / 3355125 FlyBaseID:FBgn0040009 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_956050.1 Gene:rpl5a / 326961 ZFINID:ZDB-GENE-030131-5161 Length:297 Species:Danio rerio


Alignment Length:252 Identity:44/252 - (17%)
Similarity:77/252 - (30%) Gaps:98/252 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 FGTRAAEQNYIHIFSIG-------GHVFALAYNYKTTSDSTGPDYNIELLCIYAAHVKFIKLLPM 253
            :|......||...:..|       .:.|.|...|:...:.||.::|:|          .|...|.
Zfish    86 YGIACGLTNYAAAYCTGLLCARRLLNKFGLDKVYEGQVEVTGDEFNVE----------SIDGQPG 140

  Fly   254 ENLCLIFLG--------------SGSIDMWYTSRLLSIKQRQIFHTGAEWLDYDATSANGDVYYT 304
            ...|.:..|              .|::|..     |||.     |:...:..||:.|.       
Zfish   141 AFSCYLDAGLTRTTTGNKVFGALKGAVDGG-----LSIP-----HSTKRFPGYDSESK------- 188

  Fly   305 DGNQLVRLRFKYNAQLDECFVYTLTKPVSGI----YACCWIDQKEELFCLSDNNTLYCISFGMSE 365
                      ::||::..       |.:.|:    |....:::.|||:                 
Zfish   189 ----------EFNAEVHR-------KHILGLNVSEYMSLLMEEDEELY----------------- 219

  Fly   366 MNDQTLRISTPNFAPSALMRLQHNAEALQE-YKKHPDSLRQKLYREYKQQQLISMSK 421
             ..|..|.......|          |:::| |||...|:|:....|.|.::.:...:
Zfish   220 -KKQFSRFIKNGVTP----------ESIEEMYKKAHASIRENPVHERKPKREVKKKR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17490NP_001036395.2 None
rpl5aNP_956050.1 PTZ00069 1..295 CDD:240254 44/252 (17%)
Ribosomal_L18p 26..173 CDD:279233 18/101 (18%)
Ribosomal_L18_c 192..282 CDD:290906 19/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0256
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.