powered by:
Protein Alignment CG17490 and Rpl5
DIOPT Version :9
Sequence 1: | NP_001036395.2 |
Gene: | CG17490 / 3355125 |
FlyBaseID: | FBgn0040009 |
Length: | 707 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_058676.1 |
Gene: | Rpl5 / 100503670 |
MGIID: | 102854 |
Length: | 297 |
Species: | Mus musculus |
Alignment Length: | 48 |
Identity: | 10/48 - (20%) |
Similarity: | 19/48 - (39%) |
Gaps: | 7/48 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 196 FGTRAAEQNYIHIFSIG-------GHVFALAYNYKTTSDSTGPDYNIE 236
:|.:....||...:..| .:.|.:...|:...:..|.:||:|
Mouse 86 YGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVNGGEYNVE 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0256 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.