DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17490 and Rpl5

DIOPT Version :9

Sequence 1:NP_001036395.2 Gene:CG17490 / 3355125 FlyBaseID:FBgn0040009 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_058676.1 Gene:Rpl5 / 100503670 MGIID:102854 Length:297 Species:Mus musculus


Alignment Length:48 Identity:10/48 - (20%)
Similarity:19/48 - (39%) Gaps:7/48 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 FGTRAAEQNYIHIFSIG-------GHVFALAYNYKTTSDSTGPDYNIE 236
            :|.:....||...:..|       .:.|.:...|:...:..|.:||:|
Mouse    86 YGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVNGGEYNVE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17490NP_001036395.2 None
Rpl5NP_058676.1 PTZ00069 1..295 CDD:240254 10/48 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..297
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0256
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.