DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL5 and ATL5

DIOPT Version :9

Sequence 1:NP_001036387.1 Gene:RpL5 / 3355124 FlyBaseID:FBgn0064225 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001327862.1 Gene:ATL5 / 822138 AraportID:AT3G25520 Length:301 Species:Arabidopsis thaliana


Alignment Length:282 Identity:170/282 - (60%)
Similarity:206/282 - (73%) Gaps:2/282 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDITVQIA 65
            |.|||..|:..|||||||||||||:|||||.||.||..||||||||||||.:||.:||||..||.
plant     1 MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIV 65

  Fly    66 YARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYAGCTEVTGEEF 130
            .|.|.||.|..:||:||||:||:.|||||||||||||||:|||||..|.:|..|.|..|.|||:|
plant    66 SASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDF 130

  Fly   131 NVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAETKSFNADVH 195
            :|||. |....||..|||||.|||||.|||||:|||:||||:||||.|||.|:..|.|..:|::|
plant   131 SVEPT-DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIH 194

  Fly   196 RAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIYKKAHQAIRNDPTHKVTAKKS 260
            |.:|:|.||::||:.|.|::.|..:..||.|||.|:.|:.:|::|||.|.|||.||..|.|.|.:
plant   195 RNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTVKPA 259

  Fly   261 SAVTKKRWNAKKLTNEQRKTKI 282
            .. ..||:|.||||.|:||.|:
plant   260 PK-QHKRYNLKKLTYEERKNKL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL5NP_001036387.1 PTZ00069 1..298 CDD:240254 170/282 (60%)
ATL5NP_001327862.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 226 1.000 Domainoid score I676
eggNOG 1 0.900 - - E1_COG0256
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110649
Inparanoid 1 1.050 340 1.000 Inparanoid score I642
OMA 1 1.010 - - QHG53582
OrthoDB 1 1.010 - - D999609at2759
OrthoFinder 1 1.000 - - FOG0002632
OrthoInspector 1 1.000 - - otm3441
orthoMCL 1 0.900 - - OOG6_100789
Panther 1 1.100 - - O PTHR23410
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1734
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.