DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL5 and Rpl5l1

DIOPT Version :9

Sequence 1:NP_001036387.1 Gene:RpL5 / 3355124 FlyBaseID:FBgn0064225 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_038940878.1 Gene:Rpl5l1 / 501206 RGDID:1564051 Length:297 Species:Rattus norvegicus


Alignment Length:290 Identity:190/290 - (65%)
Similarity:237/290 - (81%) Gaps:2/290 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDITVQIA 65
            |||:||||||.|||||||:|||.|.|||||.|||||..||||||||||||:|||::|:||..|||
  Rat     1 MGFMKVVKNKAYFKRYQVRFRRWRGGKTDYCARKRLVVQDKNKYNTPKYRMIVRVTNRDIICQIA 65

  Fly    66 YARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYAGCTEVTGEEF 130
            |||||||.:|||.|:|||||||::|||||||||||||||:|||:||:.|:|.:|.|..||.|:|:
  Rat    66 YARIEGDMIVCAPYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVNGDEY 130

  Fly   131 NVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAETKSFNADVH 195
            |||.:|..||||.|:||.||||||||.:||||:||||||.|:||||.|||||:.:|:|.|||:||
  Rat   131 NVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGVLSIPHSTKRFPGHDSESKEFNAEVH 195

  Fly   196 RAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIYKKAHQAIRNDPTHKVTAKKS 260
            |.||.||:||||||.|.||||:::|:|||:|||..:..|.:|::|||||.|||.:|.:....|:.
  Rat   196 RKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYDKKPKRE 260

  Fly   261 SAVTKKRWNAKKLTNEQRKTKIAAHKAAYV 290
              |.|||||..|::..|:|.::|..||:::
  Rat   261 --VKKKRWNRPKMSLAQKKDRVAQKKASFL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL5NP_001036387.1 PTZ00069 1..298 CDD:240254 190/290 (66%)
Rpl5l1XP_038940878.1 PTZ00069 1..292 CDD:240254 190/290 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23410
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.