DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL5 and rpl5

DIOPT Version :9

Sequence 1:NP_001036387.1 Gene:RpL5 / 3355124 FlyBaseID:FBgn0064225 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_988881.1 Gene:rpl5 / 394476 XenbaseID:XB-GENE-983912 Length:296 Species:Xenopus tropicalis


Alignment Length:290 Identity:205/290 - (70%)
Similarity:244/290 - (84%) Gaps:2/290 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDITVQIA 65
            ||||||||||.|||||||||||||||||||||||||..||||||||||||:|||::|:||..|||
 Frog     1 MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIA 65

  Fly    66 YARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYAGCTEVTGEEF 130
            |||||||.:|||||:|||.|||::|||||||||||||||:|||:|||.|||.:|.|..||||:|:
 Frog    66 YARIEGDMIVCAAYAHELTKYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYEGQVEVTGDEY 130

  Fly   131 NVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAETKSFNADVH 195
            |||.:|..||||.|:||.||.|||||.:||||:||||||||:||||.||||||.:|:|.|||:||
 Frog   131 NVESIDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVH 195

  Fly   196 RAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIYKKAHQAIRNDPTHKVTAKKS 260
            |.|||||::|:|||.|.||||::||:|||:|||.|:.||.:||||||||..||.:|.|:...||.
 Frog   196 RKHIFGQNIAEYMRLLTEEDEDAFKKQFSQYIKNGVTADQMEDIYKKAHAGIRENPVHEKKPKKE 260

  Fly   261 SAVTKKRWNAKKLTNEQRKTKIAAHKAAYV 290
              |.|||||..||:..|:|.::|..||:::
 Frog   261 --VKKKRWNRAKLSLAQKKDRVAQKKASFL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL5NP_001036387.1 PTZ00069 1..298 CDD:240254 205/290 (71%)
rpl5NP_988881.1 PTZ00069 1..295 CDD:240254 205/290 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 271 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H110649
Inparanoid 1 1.050 431 1.000 Inparanoid score I1681
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405247at33208
OrthoFinder 1 1.000 - - FOG0002632
OrthoInspector 1 1.000 - - oto105027
Panther 1 1.100 - - LDO PTHR23410
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1142
SonicParanoid 1 1.000 - - X1734
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.