DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL5 and CG17490

DIOPT Version :9

Sequence 1:NP_001036387.1 Gene:RpL5 / 3355124 FlyBaseID:FBgn0064225 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001036395.2 Gene:CG17490 / 3355125 FlyBaseID:FBgn0040009 Length:707 Species:Drosophila melanogaster


Alignment Length:306 Identity:54/306 - (17%)
Similarity:102/306 - (33%) Gaps:100/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTFQDKNKYNTP----KYRLIVRLSNKDITVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYA 96
            :||..:|.:.:.    :|.|        .|:::.....|..|.:          :|.:....||.
  Fly   160 ITFDQENIFQSDWQHNEYTL--------TTLKVTEKEEEFARTL----------FGTRAAEQNYI 206

  Fly    97 AAYCTGLLVARRVLNKLGLDSLYAGCTEVTGEEFNVE---------------PVDDGPGAFRCFL 146
            ..:..|..|.....|       |...::.||.::|:|               |:::     .|.:
  Fly   207 HIFSIGGHVFALAYN-------YKTTSDSTGPDYNIELLCIYAAHVKFIKLLPMEN-----LCLI 259

  Fly   147 DVGLARTTTGARVFGAMKGAVD----------GGLNIPHSVKRFPGYSAETKSFNADVHRAHIFG 201
            .:|              .|::|          ....|.|:...:..|.|  .|.|.||:  :..|
  Fly   260 FLG--------------SGSIDMWYTSRLLSIKQRQIFHTGAEWLDYDA--TSANGDVY--YTDG 306

  Fly   202 QHVADYMRSLEEEDEESFKRQFSRYIKLGIRA----DDLEDIYKKAH----------QAIRNDPT 252
            ..:.........:.:|.|....::.:. ||.|    |..|:::..:.          .:..||.|
  Fly   307 NQLVRLRFKYNAQLDECFVYTLTKPVS-GIYACCWIDQKEELFCLSDNNTLYCISFGMSEMNDQT 370

  Fly   253 HKVTAKK--SSAVTKKRWNAKKLTNEQRKTKIAAHKAAYVAKLQSE 296
            .:::...  .||:.:.:.||:.| .|.:|     |..:...||..|
  Fly   371 LRISTPNFAPSALMRLQHNAEAL-QEYKK-----HPDSLRQKLYRE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL5NP_001036387.1 PTZ00069 1..298 CDD:240254 54/306 (18%)
CG17490NP_001036395.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0256
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.