DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40006 and Scarb1

DIOPT Version :9

Sequence 1:NP_001036401.1 Gene:CG40006 / 3355123 FlyBaseID:FBgn0058006 Length:689 Species:Drosophila melanogaster
Sequence 2:XP_038945027.1 Gene:Scarb1 / 25073 RGDID:2302 Length:516 Species:Rattus norvegicus


Alignment Length:348 Identity:89/348 - (25%)
Similarity:160/348 - (45%) Gaps:33/348 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 WQEEMSGN----CREDDEVVMLNIAMLAISHLTANQPFLVRMALKTLLLSTKSEPIVRTTAKEFM 260
            |.|..|..    |.:...|:|            .::|..:::.:...|::......:..|..|.:
  Rat   135 WPEASSPGARTLCLQGGAVMM------------EDKPTSLKLLMTLGLVTMGQRAFMNRTVGEIL 187

  Fly   261 FGYPSALATLGNTFLPNWISFE-KVGLIDRMYDFSTDFETFYTGVPNPALSGLYASYRGETTLPQ 324
            :||........:.:.|:....: |.||...|.|.|:...|.:|||.|.:...|...:.|.:.:..
  Rat   188 WGYEDPFVNFLSKYFPDMFPIKGKFGLFVGMNDSSSGVFTVFTGVQNFSKIHLVDKWNGLSEVNY 252

  Fly   325 WDGDHCSNIEFASDGTKFKSFIQPNETVKFFRKSMCRPINL-YRVGNEKTYGSLKGYNYVFEDNA 388
            |..:.|:.|. .:.|..:..|:.|..:::||....||.:.| |:  ..:.:..:..|.:...|..
  Rat   253 WHSEQCNMIN-GTAGQMWAPFMTPESSLEFFSPEACRSMKLTYQ--ESRVFEGIPTYRFTAPDTL 314

  Fly   389 FDNGATNEANKCFCRKGDCQPVGLIDVTDCYYGFPISLSFPHFMNGDVGLQQNVTGISPDPDKHS 453
            |.||:....|:.||   .|:..|:.:|:.|.:|.|:.||.|||.|.|..|.:.|.|::|||.:||
  Rat   315 FANGSVYPPNEGFC---PCRESGIQNVSTCRFGAPLFLSQPHFYNADPVLSEAVLGLNPDPKEHS 376

  Fly   454 STFVIQPESGLPLSLSVKVQINMHFKDLSNFPVVSVFNHLTVPMLWFE---IMMSKLPDSLDSRF 515
            ....|.|.:|:|::.|||:|::::.|.:...........:.:|:||||   :|..|..::     
  Rat   377 LFLDIHPVTGIPMNCSVKMQLSLYIKSVKGVGQTGKIEPVVLPLLWFEQSGMMGGKTLNT----- 436

  Fly   516 NFYLNILPLVNPLGFWSGILLGI 538
             ||..::.:...|.:...:|||:
  Rat   437 -FYTQLVLMPQVLHYAQYVLLGL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40006NP_001036401.1 CD36 91..545 CDD:279474 89/348 (26%)
Scarb1XP_038945027.1 CD36 <148..454 CDD:395898 82/329 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342077
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11923
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.