DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40006 and cd36

DIOPT Version :9

Sequence 1:NP_001036401.1 Gene:CG40006 / 3355123 FlyBaseID:FBgn0058006 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001107151.1 Gene:cd36 / 100135002 XenbaseID:XB-GENE-493679 Length:470 Species:Xenopus tropicalis


Alignment Length:431 Identity:113/431 - (26%)
Similarity:198/431 - (45%) Gaps:63/431 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GFLAIITSTLIKVLEPYDLIFKWKL----IMTEGGEIFNLWAQPPVDLYIKIYLFNITNANAFLA 158
            |.|||:...|..|   .|:|...::    ::.||...:..|.:....:|...:::::||.:..:.
 Frog    17 GLLAILGGILFPV---GDMIINKEISTEAVIEEGTIAYENWIEAGSPVYRHFWIYHVTNPDEIIN 78

  Fly   159 GREQLRVEQVGPYVYK-EIMTHENVTFNSNNTMSSTPSHPLVWQEEMSGNCREDDEVVMLNIAML 222
            |.:.: ::|.|||.|: ..:..||:|...|||:|....:..::|.|.|.. .|:|...:||   |
 Frog    79 GGKPI-LQQKGPYTYRVRYLPKENITQLENNTVSYWQPNGAIFQREGSYG-PEEDTYTVLN---L 138

  Fly   223 AISHLTANQPFLVRMALKTLLLSTKSEPIVRTTAKEFMFGYPSALATLGNTFLPNWISFEKVGLI 287
            |::...|..|.|..: |..::.|:.|......:.||.::||       .:.||      ||:. |
 Frog   139 AVAAAPAMFPALQGL-LNAIIKSSNSSLFQVRSVKELLWGY-------RDPFL------EKIP-I 188

  Fly   288 DRMYDFSTDFET--FYTGVPNPALSGLYASYRGE---------------TTLPQWDGDHCSNIEF 335
            |     |.|..|  ||..  |....|:|..|.|:               ..||.|:.|.|..|. 
 Frog   189 D-----SIDKTTGLFYPN--NGTADGIYHVYNGKGDISKVAIIDRYKEAKALPYWNDDFCDMIN- 245

  Fly   336 ASDGTKFKSFIQPNETVKFFRKSMCRPINLYRVGNEKTY--GSLKGYNYVFEDNAFDNGATNEAN 398
            .:|...|...::.::.:.||...:||  ::|.: .||.|  ..:|.|.:|..::|..:...|..|
 Frog   246 GTDAASFPPSVKKDKRLYFFSSEICR--SIYGI-FEKEYMVKGIKLYRFVVTEDAMASPTKNPDN 307

  Fly   399 KCFCR----KGDCQPVGLIDVTDCYYGFPISLSFPHFMNGDVGLQQNVTGISPDPDKHSSTFVIQ 459
            .|||:    ..:|...|::|:..|..|.||.||.|||:.....|..:|:|:.|:.::|.:...::
 Frog   308 HCFCKDFQLSRNCTAAGVLDLRSCQGGKPIFLSLPHFLYASDYLLDSVSGLKPNKEEHETYIDVE 372

  Fly   460 PESGLPLSLSVKVQINMHFKDLSNFPVVS-VFNHLTVPMLW 499
            |.:|..:..:.::|:|:..:......|:| :.:.|..|:.|
 Frog   373 PITGFTMHFAKRLQVNVMIQPTDKIEVMSKLQSELVFPVAW 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40006NP_001036401.1 CD36 91..545 CDD:279474 113/431 (26%)
cd36NP_001107151.1 CD36 16..459 CDD:366481 113/431 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.