DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and CTS2

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_010659.1 Gene:CTS2 / 851977 SGDID:S000002779 Length:511 Species:Saccharomyces cerevisiae


Alignment Length:427 Identity:108/427 - (25%)
Similarity:183/427 - (42%) Gaps:128/427 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1913 YFTSWAWYRSSQGKF-VPEDIDANLCTHLIYGFAVLDSKSLTIKTHDSWTDIDNRFY-------- 1968
            |:::|:.|:.   :| .|.||:....:|:.|.|..::|::..|:..|||:|::...|        
Yeast    78 YYSNWSPYKP---RFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNS 139

  Fly  1969 ERVVEYKQRGL------------------------RVMLAIGGWNDSLGSKYARLVLNSQSRRRF 2009
            |.:.|.....:                        :|:::||||:||  ..:..::.:.:..:.|
Yeast   140 ELIKESSNNSVQNILPLGCIGELFYLKNTCSDKKFKVIMSIGGWSDS--ENFKIIIKDDKLLQNF 202

  Fly  2010 VASVISFLEQHGFEGLDLAWEFPVCWQVNCNRGNPTEKDGFVALVKEL--------SEAF---KE 2063
            |.|.:..:.:.||:|:||.||||        ..|.:|..|::.||:.|        |:.|   .|
Yeast   203 VDSSVETMFRLGFDGIDLDWEFP--------GNNESEPRGYLKLVRMLRLKLNSLESQIFGKRTE 259

  Fly  2064 NGLILSAAVSPSKMVIDAGY--NVFELSPYFDWVAVMTYDFHGHWDMRTGQIAPLFHRGGDENLY 2126
            :...||.|....|   |..:  .:.|:..|.|:..:||||::|.|...||..:.||     ....
Yeast   260 DHFQLSIAAPAFK---DKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLF-----SETE 316

  Fly  2127 LNGNFSIHYWLER-GIPNDKLVMGMPMYGQTFTLADQNRRSLNDKTV-------GPGK-AGTFTR 2182
            |||||::||.::| |:.:.|||:||..||::|.:.|......|..||       |.|| .....:
Yeast   317 LNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQNTVLINKIFKGVGKPTKEIDK 381

  Fly  2183 ADGFLAYYEICEKVVNDDWKVVRDEEGIF-------------------GSYAY--SGNQWISYDD 2226
            |||                     :|||:                   .:|.:  ..:.:||||:
Yeast   382 ADG---------------------KEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIFISYDN 425

  Fly  2227 VTTIRRKSQFIKSLQLGGGMIWALDLDDFRGLCGCGK 2263
            ..:::.|::::....||||..|.          .||:
Yeast   426 TKSVKTKAEYVTHNNLGGGFWWE----------SCGE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 106/415 (26%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 108/427 (25%)
CTS2NP_010659.1 ChiA 36..474 CDD:225862 108/427 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346211
Domainoid 1 1.000 125 1.000 Domainoid score I1191
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.