DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and AT4G19770

DIOPT Version :10

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:272 Identity:85/272 - (31%)
Similarity:121/272 - (44%) Gaps:27/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  2002 NSQSRRRFVASVISFLEQHGFEGLDLAWEFPVCWQVNCNRGNPTEKDGFVALVKE-----LSEAF 2061
            :|..|:.|:.|.||....:||:||||.||:|         .|..|...|..|:||     ..||:
plant     4 SSYGRKSFILSTISIARSYGFDGLDLDWEYP---------RNAAEMSDFAELLKEWRYAVQGEAY 59

  Fly  2062 KEN--GLILSAAVSPSKMVIDAGYNVFELSPYFDWVAVMTYDFHGHWDMR-TGQIAPLFHRGGDE 2123
            ...  .|||:|.|..|.......|.|..:|...|||.:..|||:|..... ||..|.|:.:....
plant    60 SSELPVLILTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYGPGCTEVTGPPAALYLQSDGP 124

  Fly  2124 NLYLNGNFSIHYWLERGIPNDKLVMGMPMYGQTFTLADQNRRSLNDKTVGPGKAGTFTRADGFLA 2188
                :|:..:..|::.|:|.:|.|:|.|.||..:||||.........|.||..:.     ||.::
plant   125 ----SGDSGVKDWIDAGLPAEKAVLGFPYYGWAWTLADPKNHGYYVDTTGPAISD-----DGEIS 180

  Fly  2189 YYEICEKVVNDDWKVVRDEEGIFGSYAYSGNQWISYDDVTTIRRKSQFIKSLQLGGGMIWALDLD 2253
            |.::...:|::....|.|.. :.|.|.|:|..||.||...:|..|..:.|...|.|...|.:..|
plant   181 YSQLKTWIVDNKATTVHDNI-VIGDYCYAGTTWIGYDSEESIVTKVIYAKQKGLLGYFSWQVGGD 244

  Fly  2254 DFRGLCGCGKHP 2265
            |...|...|..|
plant   245 DKSELSSAGSSP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:426342
CBM_14 875..918 CDD:426342
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 85/272 (31%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:471972 82/264 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.