DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and AT4G19760

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_193711.2 Gene:AT4G19760 / 827720 AraportID:AT4G19760 Length:369 Species:Arabidopsis thaliana


Alignment Length:387 Identity:116/387 - (29%)
Similarity:166/387 - (42%) Gaps:57/387 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1895 TSVITEPPIINNSYKVVCYFTSWAWYRS---------SQGKFVPED-IDANLCTHLIYGFAVLDS 1949
            |..:....|:..||          |:..         |||  .|.. ||:.|.|||...||.:||
plant     5 TQFLRTNSIVKASY----------WFPDGKSQSPECLSQG--TPSSFIDSTLFTHLFCAFADVDS 57

  Fly  1950 KSLTIKTHDSWTDIDNRF----YERVVEYKQRGLRVMLAIGGWNDSLGSKYARLVLNSQSRRRFV 2010
                 .||:......|.:    :...|:.|...::.:|:||| .|:..:..|.:..||::|:.|:
plant    58 -----STHEVTISAANSYQFSSFTETVKEKNTDVQTLLSIGG-KDADKAVLASMASNSKNRKAFI 116

  Fly  2011 ASVISFLEQHGFEGLDLAWEFPVCWQVNCNRGNPTEKDGFVALVKE-----LSEAFKEN--GLIL 2068
            .|.|....:..|.|||||||:|         .|..|...|..|::|     :.|:.|.|  .|:|
plant   117 DSSIDIARKKDFYGLDLAWEYP---------SNDVEMTNFGKLLEEWRAAVVEESDKTNQLPLLL 172

  Fly  2069 SAAVSPSKMVIDAGYNVFELSPYFDWVAVMTYDFHG-HWDMRTGQIAPLFHRGGDENLYLNGNFS 2132
            :|||..|.......|.|..::...|:|.:|.|||:| .|...||..|.|||...:. ...:||..
plant   173 TAAVYYSPQYDGVEYPVKAIADNLDFVNIMAYDFYGPGWSPVTGPPAALFHDPSNP-AGRSGNSG 236

  Fly  2133 IHYWL-ERGIPNDKLVMGMPMYGQTFTLADQNRRSLNDKTVGPGKAGTFTRADGFLAYYEICEKV 2196
            :..|| |..:|..|.|:|.|..|..:||.|......:..|     .|.....||.:.|.:|...:
plant   237 LRKWLDEAKLPPKKAVLGFPYCGWAWTLEDAENNGYDAAT-----DGAAISPDGSITYAKIRNYI 296

  Fly  2197 VNDDWKVVRDEEGIFGSYAYSGNQWISYDDVTTIRRKSQFIKSLQLGGGMIWALDLDDFRGL 2258
            | |:......:..:.|.|.|.||.||.|||..:|..|.::.|...|.|...|.:..|...||
plant   297 V-DNGAATFHDPAVIGFYCYVGNTWIGYDDNQSIVYKVKYAKFTGLLGYFSWHVGADYNCGL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 109/366 (30%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 112/372 (30%)
AT4G19760NP_193711.2 GH18_plant_chitinase_class_V 11..358 CDD:119358 115/381 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.