DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and AT4G19750

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_193710.2 Gene:AT4G19750 / 827719 AraportID:AT4G19750 Length:362 Species:Arabidopsis thaliana


Alignment Length:390 Identity:113/390 - (28%)
Similarity:158/390 - (40%) Gaps:57/390 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1895 TSVITEPPIINNSYKVVCYFTSWAWYRSSQGKFVPEDIDANLCTHLIYGFAVLDSKSLTIKTHDS 1959
            |..:....|:..||          |....:..|...:||:...|||...||.:||     .||:.
plant     5 TQFLRTNSIVKASY----------WVVKPENDFPAGNIDSTRFTHLFCAFADVDS-----STHEV 54

  Fly  1960 WTDIDN----RFYERVVEYKQRGLRVMLAIGGWNDSLGSKYARLVLNSQSRRRFVASVISFLEQH 2020
            .....|    ..:...|:.|...::.:|:||| .|:..:..|.:..||::|:.|:.|.|....:.
plant    55 TISAANSCQVSSFTHTVKDKNTDVQTLLSIGG-KDADKAVLASMASNSKNRKAFIDSSIDIARKK 118

  Fly  2021 GFEGLDLAWEFPVCWQVNCNRGNPTEKDGFVALVKELSEAFKENG-------LILSAAVSPSKMV 2078
            .|.|||||||:|         .|..|...|..||||...|..|..       |:|:|||..|...
plant   119 DFYGLDLAWEYP---------SNDVEMANFGKLVKEWRAAVVEESDRTNQLPLLLTAAVYYSPDY 174

  Fly  2079 IDAGYNVFELSPYFDWVAVMTYDFHG-HWDMRTGQIAPLFH------RGGDENLYLNGNFSIHYW 2136
            ....|.|..::...|:|.:|.|||:| .|...||..|.||.      |.||..|        ..|
plant   175 YGEEYPVQAIADNLDFVNIMAYDFYGPGWSPVTGPPAALFDPSNPAGRSGDSGL--------SKW 231

  Fly  2137 LERGIPNDKLVMGMPMYGQTFTLADQNRRSLNDKTVGPGKAGTFTRADGFLAYYEICEKVVNDDW 2201
            ||..:|..|.|:|....|..:||.|......:..|     .|....:||.:.|.:|...:: |:.
plant   232 LEAKLPAKKAVLGFSYCGWAWTLEDAENNGYDAAT-----DGAAISSDGSITYAKIRNYII-DNG 290

  Fly  2202 KVVRDEEGIFGSYAYSGNQWISYDDVTTIRRKSQFIKSLQLGGGMIWALDLDDFRGLCGCGKHPL 2266
            .....:..:.|.|.|.|..||.|||..:|..|.::.|...|.|...|.:..|...||...|...|
plant   291 AATFHDPAVIGFYCYVGTTWIGYDDNQSIVSKVRYAKLKGLLGYFSWHVGADYNCGLSRAGSFSL 355

  Fly  2267  2266
            plant   356  355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 104/361 (29%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 109/375 (29%)
AT4G19750NP_193710.2 GH18_plant_chitinase_class_V 11..348 CDD:119358 109/375 (29%)
Glyco_18 14..342 CDD:214753 106/366 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.