DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and Muc26B

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster


Alignment Length:281 Identity:70/281 - (24%)
Similarity:100/281 - (35%) Gaps:76/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 PPTQPNCKRPTLLATPVPPQMTTISSDGSGGLGQNHDHTTSLPSGQISSSPVSTTI---TSTFPW 654
            |.|...| .||...|..|...||.:...:         ||..|:...:.:|.:||.   |:|...
  Fly   239 PTTTTTC-APTTTTTCAPTTTTTCAPTTT---------TTCAPTTTTTCAPTTTTTCAPTTTTTC 293

  Fly   655 WSSTTKRPREPTKTTAQPTHTTILIP---AGINPVVQPSNCKSGEFFADSNNCNAYYHCFFAGEL 716
            ..:||......|.||..||.||...|   ....|.:..:.|..    |.:..|........|...
  Fly   294 APTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCTPGITTTTCTP----ATTTTCVPETTTSCASST 354

  Fly   717 QQQFC--PSGLHWNNEAKGCDWPSSAQCSLKLDQHLSTSYPNPIQTSKKPETTLKPNKKPS-EIS 778
            ....|  .||:..:::|:    |||.:.                    :|...::|..:|: ||.
  Fly   355 TTTECGPVSGVSGSSKAR----PSSVKV--------------------RPARPVRPAVRPALEID 395

  Fly   779 THHQVNSTSSRPQYMRPTILECTEGDY--YPHRN------------CRKYYIC-VNKALVPSECG 828
                        :...|...|.|...|  |..||            |..|||| ..|.|:.| | 
  Fly   396 ------------ELSAPKAQELTMSTYTKYVCRNKPDGFMLASLKSCSDYYICRYGKPLLVS-C- 446

  Fly   829 GDLHWDGIKKLCDWPENVQCV 849
            ||.:::.:|.:||.|||.:||
  Fly   447 GDKYFNALKGICDLPENTRCV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696 7/41 (17%)
CBM_14 801..848 CDD:279884 22/61 (36%)
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Muc26BNP_652552.1 CBM_14 43..86 CDD:279884
CBM_14 415..463 CDD:279884 17/49 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.