DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and obst-H

DIOPT Version :10

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:267 Identity:66/267 - (24%)
Similarity:109/267 - (40%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 GEFFADSNNCNAYYHCFFAGELQQQFCPSGLHWNNEAKGCDWPSSAQCSLKLDQHLSTSYPNPIQ 759
            |.|.....:|.:|.:|.....|:.. |..|.::::||..||..::..|.  ||:....|.|.| :
  Fly    32 GAFVQSWESCQSYVYCEGEESLKGD-CEDGEYFDSEAGTCDIAANVSCF--LDEVDEPSDPEP-E 92

  Fly   760 TSKKPE---TTLKPNKKPSEISTHHQVNSTSSRPQYMRPTILECTEGD-------YYPHRNCRKY 814
            |.::.|   .|.:|.:.|. :.|..:|:..:..| .:||   .|...|       ...:.:|..|
  Fly    93 TDEEEEEIPATPRPTEPPI-VETPTEVDIINIAP-VVRP---NCPISDDPGQVIFMASNNSCTNY 152

  Fly   815 YICVNKALVPSECGGDLHWDGIKKLCDWPENVQCVTSKKYLKIIKSSSANEEDPCKGEKRV---- 875
            |:|.:...:...|..:|:::.:...||:|:.|||..               ||| :..|.:    
  Fly   153 YLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAF---------------EDP-RSHKCLPHMT 201

  Fly   876 ---PYPGNCSKYLFCLWNRLQASDCPPGLHYN---ERIGNCDWPAAAKCNPKGSESSEEAELNAM 934
               |:|.||:.:.:|:...|....||  .:|.   || .:|.....|||.........:|     
  Fly   202 EFFPHPDNCNYFYYCIKGFLTLQQCP--FYYGWDIER-RSCVQIGVAKCYGNSRRIGRKA----- 258

  Fly   935 PKPPTPQ 941
            |.||..|
  Fly   259 PLPPRKQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696 11/39 (28%)
CBM_14 801..848 CDD:426342 11/53 (21%)
CBM_14 875..918 CDD:426342 13/52 (25%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
obst-HNP_001034020.1 CBM_14 26..77 CDD:426342 12/45 (27%)
CBM_14 142..184 CDD:426342 9/41 (22%)
ChtBD2 203..240 CDD:214696 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.