DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and Idgf3

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster


Alignment Length:432 Identity:119/432 - (27%)
Similarity:206/432 - (47%) Gaps:83/432 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1910 VVCYFTSWAWYRSSQGKFVPEDIDANL--CTHLIYGFAVLDSKSLTIKTHDSWTDIDNRFYERVV 1972
            :||::.|....|....:|...||:..|  ||||:||:|.:::.:..:::.:...|::.|...::.
  Fly    27 LVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNADNYEMQSINKRLDLEQRHLAQIT 91

  Fly  1973 EYKQR--GLRVMLAIGGWNDSL-GSKYARLV-LNSQSRRRFVASVISFLEQHGFEGLDLAWEFPV 2033
            ..|:|  .::.:|::||..|:. |::|.:|: ...|..|||:.|....:.::.|:|||||.:.| 
  Fly    92 SMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQLP- 155

  Fly  2034 CWQVNCNRGNP-----------------------------TEKDGFVALVKELSEAFKENGLILS 2069
                   |..|                             |.|....||:|:||.|.|:|.|:||
  Fly   156 -------RNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDLSAALKQNDLLLS 213

  Fly  2070 AAVSPSKMVIDAG--YNVFELSPYFDWVAVMTYDFHGHWDMRTGQ--------IAPLFHRGGDEN 2124
            ..|.|:   :::.  |:...::|..|::.:.|:||      .|.|        .||.:...|...
  Fly   214 LTVLPN---VNSSWYYDAPSIAPSLDFINLGTFDF------LTPQRNPEEADFSAPTYEAVGQNR 269

  Fly  2125 L-YLNGNFSIHYWLERGIPNDKLVMGMPMYGQTFTLADQNRRS---LNDKTVGPGKAGTFTRADG 2185
            | :.|.||.:.:||.:.:|.:|:.:|:..||:::.::..:..|   :...|.||..||..::.:|
  Fly   270 LGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSGMPVVPSTQGPAPAGPQSKQEG 334

  Fly  2186 FLAYYEICEKVVNDD----------WKVVRDEEGIFGSYAY-----SGNQ--WISYDDVTTIRRK 2233
            .|.:.|||..:.|..          .|.|.|....:||||:     :|:.  ||||||..:...|
  Fly   335 LLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAADENGDHGLWISYDDPDSASSK 399

  Fly  2234 SQFIKSLQLGGGMIWALDLDDFRGLCGCGKHPLLRTLSQELL 2275
            :.:.::..|||..::.|..|||||.|...:.|:||.:...||
  Fly   400 AMYARARNLGGVALFDLTQDDFRGQCTNDRFPMLRAIKYRLL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 108/408 (26%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 117/429 (27%)
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 117/429 (27%)
Glyco_18 27..419 CDD:214753 108/408 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.