DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and Idgf1

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster


Alignment Length:425 Identity:121/425 - (28%)
Similarity:203/425 - (47%) Gaps:78/425 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1910 VVCYFTSWAWYRSSQGKFVPEDIDANL--CTHLIYGFAVLDSKSLTIKTHDSWTDIDNRFYERVV 1972
            ::||:.|.::.|....|....::|..|  ||||:||:|.|  ||.|::......|:|..:|:.:.
  Fly    24 LICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGL--KSGTLELFSLNVDLDMFYYKDIT 86

  Fly  1973 EYKQR--GLRVMLAIGGWND---SLGSKYARLV-LNSQSRRRFVASVISFLEQHGFEGLDLAWEF 2031
            ..:|:  .|:::|::||..|   :..:||..|: .|..:::.|:.|.:..|:::||:|||||::.
  Fly    87 ALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQNFIDSSMILLKRNGFDGLDLAFQL 151

  Fly  2032 PVCWQVNCNRGNPTE-----------------------------KDGFVALVKELSEAFKENGLI 2067
            |        |..|.:                             |..|..||..:..||:...|:
  Fly   152 P--------RNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGNIKNAFRSANLM 208

  Fly  2068 LSAAVSPSKMVIDAGY-NVFELSPYFDWVAVMTYDFHGHWDMRTGQ----IAPLFHRGGDENL-Y 2126
            ||..|.|:  |....| :|.:|.|.||::.:..:||  ...:|..:    .||:|.:.....| :
  Fly   209 LSLTVLPN--VNSTWYFDVPKLHPQFDYINLAAFDF--LTPLRNPEEADFTAPIFFQDEQNRLPH 269

  Fly  2127 LNGNFSIHYWLERGIPNDKLVMGMPMYGQTFTLADQNRRS---LNDKTVGPGKAG-TFTRADGFL 2187
            ||..|.|:|||:...|..||.:|:..||:.:.|:..:..|   :..:|.|....| ....|:|.|
  Fly   270 LNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSGLSGAPIVHETCGVAPGGIQIQSAEGLL 334

  Fly  2188 AYYEICEKVVND----------DWKVVRDEEGIFGSYAY-----SGN--QWISYDDVTTIRRKSQ 2235
            ::.|||.|:..:          ..:.|.|....:|:||.     :|:  .|:|:||......|:.
  Fly   335 SWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRPADDNGDFGVWLSFDDPDFAGIKAV 399

  Fly  2236 FIKSLQLGGGMIWALDLDDFRGLCGCGKHPLLRTL 2270
            :.|...|||..::.|..|||||||...|:|:||::
  Fly   400 YAKGKGLGGIALFDLSYDDFRGLCTGQKYPILRSI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 110/406 (27%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 121/425 (28%)
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 121/425 (28%)
Glyco_18 24..417 CDD:214753 110/406 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463779
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.