DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and CG8460

DIOPT Version :10

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:108/268 - (40%) Gaps:65/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1500 LVRNPEARSRFIRNVLDFIEEYNFDGLDLD-WEYPVCWQVDCKKGTAEEKIGFSALVRELFYAFQ 1563
            |:.:.:.|::....::...::..||||.|: |..        ..|..::||.:: ||.::....|
  Fly   172 LLSDAQERTKVNDVLIKCCKDNGFDGLVLEVWSQ--------LAGRIDDKILYT-LVLQMAKELQ 227

  Fly  1564 PRGLILSAAVSPNKKVIDAGYEVAE------LSHYFSWISVMAYDYHGQWDKKTGHVAPMY---- 1618
            .:.|.|...:.|.:|  :.|:...|      ..|.::: |:|.||:...  ::.|..||:|    
  Fly   228 KQQLRLILVIPPFRK--ETGHLFGEKHMDKLFKHIYAF-SLMTYDFSSV--QRPGANAPLYFVRK 287

  Fly  1619 ----SHPEGTANFNANFSMNYWISMGADRRKLVMGIPLYGQSFSLAETTKHQLNAPTYGGGEAGE 1679
                ..|||.|:            |.|.|.|:::|:.:||..:             |..||  |.
  Fly   288 AVETIAPEGCAD------------MTAKRAKILLGLNMYGNDY-------------TPDGG--GP 325

  Fly  1680 ATRARGFLAYYEICLKIRHHRWNVVRDTKGRIGPFAYHGDQWVSFDDVPMIRHKSEYIK-AMGLG 1743
            .|    |..|.::   :||.:.::..|.:.....|....|........|.:...:|.|| |..||
  Fly   326 IT----FSQYLDL---VRHVKKHLTYDERDVENFFEIKNDDGRHIVFYPTLYSINERIKLAQELG 383

  Fly  1744 -GAMIWAL 1750
             |..||.|
  Fly   384 TGISIWEL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:426342
CBM_14 875..918 CDD:426342
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 63/268 (24%)
ChtBD2 1834..1871 CDD:214696
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 63/268 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.