DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and CG8460

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:108/268 - (40%) Gaps:65/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1500 LVRNPEARSRFIRNVLDFIEEYNFDGLDLD-WEYPVCWQVDCKKGTAEEKIGFSALVRELFYAFQ 1563
            |:.:.:.|::....::...::..||||.|: |..        ..|..::||.:: ||.::....|
  Fly   172 LLSDAQERTKVNDVLIKCCKDNGFDGLVLEVWSQ--------LAGRIDDKILYT-LVLQMAKELQ 227

  Fly  1564 PRGLILSAAVSPNKKVIDAGYEVAE------LSHYFSWISVMAYDYHGQWDKKTGHVAPMY---- 1618
            .:.|.|...:.|.:|  :.|:...|      ..|.::: |:|.||:...  ::.|..||:|    
  Fly   228 KQQLRLILVIPPFRK--ETGHLFGEKHMDKLFKHIYAF-SLMTYDFSSV--QRPGANAPLYFVRK 287

  Fly  1619 ----SHPEGTANFNANFSMNYWISMGADRRKLVMGIPLYGQSFSLAETTKHQLNAPTYGGGEAGE 1679
                ..|||.|:            |.|.|.|:::|:.:||..:             |..||  |.
  Fly   288 AVETIAPEGCAD------------MTAKRAKILLGLNMYGNDY-------------TPDGG--GP 325

  Fly  1680 ATRARGFLAYYEICLKIRHHRWNVVRDTKGRIGPFAYHGDQWVSFDDVPMIRHKSEYIK-AMGLG 1743
            .|    |..|.::   :||.:.::..|.:.....|....|........|.:...:|.|| |..||
  Fly   326 IT----FSQYLDL---VRHVKKHLTYDERDVENFFEIKNDDGRHIVFYPTLYSINERIKLAQELG 383

  Fly  1744 -GAMIWAL 1750
             |..||.|
  Fly   384 TGISIWEL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753 63/268 (24%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 63/268 (24%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 63/268 (24%)
Glyco_18 86..393 CDD:214753 63/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.