DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and chia.4

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_956740.1 Gene:chia.4 / 337333 ZFINID:ZDB-GENE-030131-9279 Length:475 Species:Danio rerio


Alignment Length:409 Identity:149/409 - (36%)
Similarity:228/409 - (55%) Gaps:41/409 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 KVICYFTNWAWYRKGIGRFTPDDINTELCTHVIYGFAVLDYSELVLRTHDSWADVENNFYTRVTS 1030
            ::.|||.||:.||..:|::.|.:::..||||:||.|:|::....:..:  .|.|  ...|....:
Zfish    22 QLACYFANWSQYRPDVGKYMPSNVDPHLCTHLIYAFSVINIKNKLATS--EWND--ETLYQSFNA 82

  Fly  1031 LK--SKGIKVSLALGGWNDSQGDKYSRLVRSPMARSRFVRHALEFIEKYGFEGLDLDWEYPVCWQ 1093
            ||  :..:|..||:|..| ....::||:|.:|..|..|:..:::|:..:||:|||||||||    
Zfish    83 LKQSNPNLKTLLAVGTLN-LGSTQFSRMVSTPQKRQTFIESSIKFLRTHGFDGLDLDWEYP---- 142

  Fly  1094 TECNKGSTEEKDGFTAWVQELSEAF--------RPRGLMLSTAVSPSRKIIDAGYDIPQLSRYFD 1150
             ...:...|:|..||...:||.:|:        ||| |||:.||:..:.||||||:|.::|:|.|
Zfish   143 -GSGESPPEDKHRFTLLCKELLKAYQAESKATRRPR-LMLTAAVAARKGIIDAGYEIAEVSKYLD 205

  Fly  1151 WIAVMTYDFHGHWDKKTGHVAPLYHHPDD--DFEYFNVNYSINYWMEKGAPSQKLVMGIPLYGQS 1213
            :|.:|||||||.|:..|||.:|||....|  |..|:|.::::.||.::|||.:||.||...||::
Zfish   206 FINIMTYDFHGSWENVTGHNSPLYRDSRDTGDQIYYNTDFAMTYWRDQGAPVEKLRMGFAAYGRT 270

  Fly  1214 FTLENTNSSGLNAKAPAPGEAGEFTRAAGFLAYYEICERVNRQGWQVVHDEFGRMGPYAYKGTQW 1278
            |.|.:. .:||.|....|..||.:||.||:.:|||||..:.|...:.:.|:   ..|||.:|..|
Zfish   271 FCLSSA-VNGLGAPVSGPASAGTYTREAGYWSYYEICTFLQRASVEQIADQ---KVPYATEGLNW 331

  Fly  1279 VSYDSPDMVRKKSLLVRSLKLGGGMVWALDLDDFKNR-CGNGVHPLLTEIHNVL-------KDPP 1335
            |.:|.......|...::....||..||:||||||..: ||.|.:||:..:|.:|       :..|
Zfish   332 VGFDDQKSYETKVDYLKEKGFGGAFVWSLDLDDFSGQFCGQGKYPLIGHLHTLLNISNTEFRHLP 396

  Fly  1336 SLMEIPGP------IETTP 1348
            ..::..|.      :.|||
Zfish   397 KTIKSGGASATGNIVTTTP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 133/355 (37%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 143/376 (38%)
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
chia.4NP_956740.1 Glyco_18 22..363 CDD:214753 133/355 (37%)
GH18_chitolectin_chitotriosidase 25..381 CDD:119351 142/370 (38%)
ChtBD2 425..473 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6443
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.