DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and Idgf4

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster


Alignment Length:433 Identity:133/433 - (30%)
Similarity:211/433 - (48%) Gaps:78/433 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   963 SHYKVICYFTNWAWYRKGIGRFTPDDINTEL--CTHVIYGFAVLDYS--ELVLRTHDSWADVENN 1023
            ||: ::||:...::.|:|:.:....|:...|  |||::||:|.::.|  :||........|:.::
  Fly    24 SHH-LLCYYDGNSFVREGLSKLILTDLEPALQYCTHLVYGYAGINPSSNKLVSNNEKLDLDLGSS 87

  Fly  1024 FYTRVTSLKSK--GIKVSLALGGWNDS---QGDKYSRLVRSPMARSRFVRHALEFIEKYGFEGLD 1083
            .:.:||.||.|  .:||.|::||..|:   :.:||..|:.|..||..|:..|...::.|||:|||
  Fly    88 LFRQVTGLKRKYPALKVLLSVGGDKDTVDPENNKYLTLLESSNARIPFINSAHSLVKTYGFDGLD 152

  Fly  1084 LDWEYP------------VCWQTECNKG--------------STEEKDGFTAWVQELSEAFRPRG 1122
            |.|::|            ..|     ||              :.|.|:.|||.|:||..||||.|
  Fly   153 LGWQFPKNKPKKVHGSIGKFW-----KGFKKIFSGDHVVDEKAEEHKEAFTALVRELKNAFRPDG 212

  Fly  1123 LMLSTAVSPSRKIIDAG--YDIPQLSRYFDWIAVMTYDFHGHWDKKTGHV----APLYHHPDDDF 1181
            .:|..:|.|:   :::.  :|:|.:....|::.:.||||  ...::...|    ||:|...:.:.
  Fly   213 YILGLSVLPN---VNSSLFFDVPAIINNLDYVNLHTYDF--QTPERNNEVADFPAPIYELNERNP 272

  Fly  1182 EYFNVNYSINYWMEKGAPSQKLVMGIPLYGQSFTLENTNSSGLN-----AKAPAPGEAGEFTRAA 1241
            | |||||.:.||....||:.|:.:||..||:::.|  |..|||.     |:|.....||..|:..
  Fly   273 E-FNVNYQVKYWTGNRAPAAKINVGIATYGRAWKL--TKDSGLTGLPPVAEADGVAPAGTQTQIP 334

  Fly  1242 GFLAYYEICERVNRQGWQ----------VVHDEFGRMGPYAYKGTQ-------WVSYDSPDMVRK 1289
            |.|::.|:|.::.....|          .|.|...|.|.|||:...       ||.|:.||....
  Fly   335 GLLSWPEVCAKLPNPANQHLKGADGPLRKVGDPTKRFGSYAYRSADDSGENGVWVGYEDPDTAAI 399

  Fly  1290 KSLLVRSLKLGGGMVWALDLDDFKNRC-GNGVHPLLTEIHNVL 1331
            |:..|:...|||..|..|..|||:..| |:...|:|.::.:.|
  Fly   400 KAEYVKREGLGGIAVVDLSFDDFRGGCTGHDKFPILRQVKSKL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 123/406 (30%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 130/427 (30%)
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 130/429 (30%)
Glyco_18 27..420 CDD:214753 123/405 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463776
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.