DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and Muc96D

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_733106.2 Gene:Muc96D / 318737 FlyBaseID:FBgn0051439 Length:881 Species:Drosophila melanogaster


Alignment Length:257 Identity:59/257 - (22%)
Similarity:98/257 - (38%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 TLLATPVPPQMTTISSDGSGGLGQNHDHTTSLPSGQISSSPVSTTITSTFPWWSSTTKRPREPTK 667
            |...|...|..||.::..:.........||:..:...:::..:||..:|....::||......|.
  Fly   650 TTTTTTCTPTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTCTTTTTTTTTTTTTTTTTT 714

  Fly   668 TTAQPTHTTILIPAGINPVVQPSNCKSGEFFADSNNCNAYYHCFFAGELQQQFCPSGLHWNNEAK 732
            ||..||.||...|.............|....:.:..|.       :..:....||...       
  Fly   715 TTCAPTTTTTCTPTTTTTTTCAPTTSSTTTTSTTTTCT-------SKTISTTTCPETA------- 765

  Fly   733 GCDWPSSAQCSLKLDQHLSTSYPN------PIQTSKKPETTLKPNKKPSEISTHHQVNSTSSRPQ 791
                |::..||    ...:|..|.      ..|:.:.|......|:...|::....::|:||..|
  Fly   766 ----PTTTACS----DVTTTVCPTESKAVAATQSKRNPVRRNPVNRLLWEVAEWAGLSSSSSEAQ 822

  Fly   792 YMRPTILECTEGDYY--PHRNCRKYYICVNKALVPSECGGDLHWDGIKKLCDWPENVQCVTS 851
             ::.:.|...:|...  |.| |..||||.::..:...| ||.:::|:|.:||.|||..||.|
  Fly   823 -LKVSCLGKPDGFLMASPER-CNDYYICRHQRALKVSC-GDRYFNGLKGICDLPENTSCVQS 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696 3/39 (8%)
CBM_14 801..848 CDD:279884 18/48 (38%)
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Muc96DNP_733106.2 ChtBD2 29..72 CDD:214696
CBM_14 827..875 CDD:279884 17/49 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.