DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and Cht11

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster


Alignment Length:390 Identity:111/390 - (28%)
Similarity:197/390 - (50%) Gaps:52/390 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1410 KIICYFTNWAWYRQGGGKFLPEDIDSDLCTHIIYGFAVLSRDNLTIQPHDSWADL---DNKFYER 1471
            :::||:.:     .|.......|:..||||||..|.|.|  ||.||...|:...:   |.:    
  Fly    68 RLVCYYAS-----DGTHNLSLLDVPGDLCTHINIGPATL--DNATIVLPDTLRQVLQNDTR---- 121

  Fly  1472 IVAYRKKGAKVTVA--IGGWNDSAGDKYSRLVRNPEARSRFIRNVLDFIEEY-NFDGLDLDWEYP 1533
              ::|....:|.:.  |||  ..:|..::.:|.|...|..|:|::.:.:..| :.||:|||||:|
  Fly   122 --SFRAAHPQVHLLLWIGG--ADSGRSFALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFP 182

  Fly  1534 VCWQVDCKKGTAEEKIGFSALVRELFYAFQPR---GLILSAAVSPNKKVIDAGYEVAELSHYFSW 1595
            ..:.        .|::..|.|:.|:...::..   ..|||.||:..:.:....|::.|::.|..:
  Fly   183 SAYD--------RERMHLSQLLYEIRTEWRREKRTNDILSLAVAAPEGIAFYAYDIREINLYADY 239

  Fly  1596 ISVMAYDYHGQWDKK--TGHVAPMYSHPEG---TANFNANFSMNYWISMGADRRKLVMGIPLYGQ 1655
            :::|:||:|...:..  ||..||:|:..:.   .|.||.|:::.:|:..|.:.::||:|:|.||.
  Fly   240 VNLMSYDFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGH 304

  Fly  1656 SFSLAETTKHQLNAPTYGGGEAGEATRARGFLAYYEICLKI-RHHRWNVVRDTKGRIGPFAYHGD 1719
            ||:|.....|::.||..|.|:.|:.    ||....|.|..: :..:.|:..|.:. ..|:.....
  Fly   305 SFTLVNPLNHRIGAPASGYGKCGQL----GFTTLTETCECVTKFFKPNLSYDAES-CSPYLSALQ 364

  Fly  1720 QWVSFDDVPMIRHKSEYIKAMGLGGAMIWALDLDDFKNVC---------ECESYPLLKAINRVLR 1775
            :|:|:::...|..|:.|:|::.|||.|:::|:.||.||.|         |...:||.:||..:||
  Fly   365 EWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNSCSIMPNLKYSEKPVFPLTQAIKDILR 429

  Fly  1776  1775
              Fly   430  429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753 99/357 (28%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 109/386 (28%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 99/357 (28%)
GH18_chitinase-like 69..428 CDD:299167 109/386 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.