DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and Cht12

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster


Alignment Length:427 Identity:129/427 - (30%)
Similarity:209/427 - (48%) Gaps:50/427 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   965 YKVICYFTNWAWYRKGIGRFTPDDINTELCTHVIYGFAV-LDYSELVLRTHDSWADVENNFYTRV 1028
            |.|.|.:...::|.||..:|....:::.||||::.|..: :|.....||..|....:|.:..:.|
  Fly    23 YNVFCQYDLGSYYYKGRSQFFEWHLDSRLCTHLVLGSGIGVDGDSGELRITDKILLLEKDKLSSV 87

  Fly  1029 TSLKSKGI-KVSLALGGWNDSQGDKYSRLVRSPMARSRFVRHALEFIEKYGFEGLDLDWEYPVCW 1092
            .::|...| ||...:||| :.....:||:|.||..|..|....|||:.::||:|:.:||.||...
  Fly    88 KTMKWDSIKKVMFTIGGW-EEDSSSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQIDWRYPTLL 151

  Fly  1093 QTECNKGSTEEKDGFTAWVQELSEAFRPRGLMLSTAVSPSR--KIIDAGYDIPQLSRYFDWIAVM 1155
                 .|..:::..|...::||...||...|:|..||...|  :|::: |:||::..:.|:|.:|
  Fly   152 -----GGHPDDRQNFVILLEELGLIFRKNQLILMVAVLGRRDNRILES-YNIPEIVNHSDFIHLM 210

  Fly  1156 TYDFHGHWDKKTGHVAPLYHHPDDDFEYFNVNYSINYWMEKGAPSQKLVMGIPLYGQSFTLENTN 1220
            .:|....:..:..:.|||..:..      :|..||.:|...|...:||::||||:.:|||::. |
  Fly   211 MHDEQDPYHLRLAYNAPLVGYEG------SVTDSIMHWKRNGGAPEKLILGIPLFVRSFTMDR-N 268

  Fly  1221 SSGLNAKAPAPGEAGEFTRAAGFLAYYEICERVNRQGWQVVHDEFGRMGPYAYKGTQWVSYDSPD 1285
            .|.:.:....||...:.:...||:.|.|.|  |.:..|..:.|:..:: |||.:|.|||||::|.
  Fly   269 QSTVGSACKGPGRQTKQSHRPGFMTYNEWC--VQQSKWSRMFDQLAKV-PYATRGDQWVSYENPR 330

  Fly  1286 MVRKKSLLVRSLKLGGGMVWALDLDDFKNRCGNGVHPLLTEIHNVLKDPPSLMEIPGPIETTPTE 1350
            .:..|..|::..||||.|.|.:|:|||:.|||. .|.||..|.:.|.|...|     ..|...||
  Fly   331 SIWAKMHLLQEHKLGGAMAWTIDVDDFRGRCGE-QHGLLRVIFSALGDKNGL-----TTEKPTTE 389

  Fly  1351 YPGMEEEIHESNGEGPEVQPIEAVMQTCENEGEEHEG 1387
            ..|:                       |.::|...:|
  Fly   390 ASGL-----------------------CPHDGFSRDG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 108/347 (31%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 118/367 (32%)
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 118/367 (32%)
Glyco_hydro_18 47..355 CDD:279094 102/324 (31%)
ChtBD2 394..438 CDD:214696 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.