DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and cht-4

DIOPT Version :10

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_497437.2 Gene:cht-4 / 189507 WormBaseID:WBGene00021252 Length:360 Species:Caenorhabditis elegans


Alignment Length:386 Identity:102/386 - (26%)
Similarity:156/386 - (40%) Gaps:76/386 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   967 VICYFTNWAWYRKGIGRFTPDDIN---TELCTHVIYGFAVLDYSELVLRTHDS--------WADV 1020
            |.||:.           ....||:   ..||||:|          |:...|.|        ..|:
 Worm    20 VACYYI-----------LNQPDISKVPKNLCTHII----------LINSAHVSEDGRLQGFEQDL 63

  Fly  1021 ENNFYTRVTSLKSKGIKVSLALGGWNDSQGDKYSRLVRSPMARSRFVRHALEFIEKYGFEGLDLD 1085
            |:     .:.|....|::.:::...|.|    :|.|..:......|.....:.::||...|:|:|
 Worm    64 EH-----FSELFDGKIELFVSITSSNPS----FSFLTSNTTLMHNFSSTVTQVLQKYRLNGVDID 119

  Fly  1086 WEYPVCWQTECNKGSTEEKDGFTAWVQELSEAFRPRGLMLSTAVSPSRKIIDAGYDIPQLSRYFD 1150
            ||:|| |..:..|   .:|..|..:::.|....:|..|.||.|||....|....||:..|..|.|
 Worm   120 WEFPV-WSRDAQK---SDKAHFATFLRILKSHLKPADLKLSVAVSGPPTISRKAYDVDALKMYAD 180

  Fly  1151 WIAVMTYDFH---GHWDKKTGHVAPLYHHP----DDDFEYFNVNYSINYWMEKGAPSQKLVMGIP 1208
            .:.:|.||||   .:.:...|..|||  ||    .......|...|:..|.:.|.|......|||
 Worm   181 MVQIMNYDFHVFNRYSNPFVGFNAPL--HPMRAEISVLGEMNAEASMKTWYDLGLPRNISFFGIP 243

  Fly  1209 LYGQSFT-----LENTNSSGLNAKAPAPGEAGEFTRAAGFLAYYEICERVNRQGWQVVHDEFGRM 1268
            .|.::|.     |....|..:.|:.       |.|...      ::|.......:..|.:...: 
 Worm   244 TYARAFQLLTHYLHKPYSPAIRARP-------EITNLP------DVCIFAQSGYYTTVWNHHAQ- 294

  Fly  1269 GPYAYKGTQ--WVSYDSPDMVRKKSLLVRSLKLGGGMVWALDLDDFKNRCGNGVHPLLTEI 1327
            .||.| |..  ||||::...:..|....|.|::||.||:::..||...:||:|.:||||:|
 Worm   295 APYLY-GDDGIWVSYENQQSILAKMAFARKLQVGGVMVFSIGSDDVTGKCGHGPYPLLTKI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:426342
CBM_14 875..918 CDD:426342
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 102/386 (26%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
cht-4NP_497437.2 GH18_chitinase-like 30..357 CDD:471972 99/365 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.