Sequence 1: | NP_001036422.1 | Gene: | Cht10 / 3355116 | FlyBaseID: | FBgn0250907 | Length: | 2286 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496035.1 | Gene: | chil-27 / 188616 | WormBaseID: | WBGene00011848 | Length: | 407 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 49/207 - (23%) |
---|---|---|---|
Similarity: | 89/207 - (42%) | Gaps: | 39/207 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1880 SNQRTQEPAVHRPNPTSVITEPPIINNSYKVVCYFTSWAWYRSSQGKFVPEDIDANLCTHLIY-- 1942
Fly 1943 ------GFAVLDSKSLTIKTHDSWTDIDNRFYERVVEYKQRGLRVMLAIGGWNDSLGSKYARLVL 2001
Fly 2002 -NSQSRRRFVASVISFLEQHGFEGLDLAWEFPVCWQVNCNRGNPTEK-DGFVALVKELSEAFKEN 2064
Fly 2065 GLILSAAVSPSK 2076 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cht10 | NP_001036422.1 | Glyco_18 | 220..565 | CDD:214753 | |
GH18_chitolectin_chitotriosidase | 221..586 | CDD:119351 | |||
ChtBD2 | 697..737 | CDD:214696 | |||
CBM_14 | 801..848 | CDD:279884 | |||
CBM_14 | 875..918 | CDD:279884 | |||
Glyco_18 | 966..1310 | CDD:214753 | |||
GH18_chitolectin_chitotriosidase | 967..1331 | CDD:119351 | |||
Glyco_18 | 1410..1753 | CDD:214753 | |||
GH18_chitolectin_chitotriosidase | 1411..1774 | CDD:119351 | |||
ChtBD2 | 1834..1871 | CDD:214696 | |||
Glyco_18 | 1909..2253 | CDD:214753 | 40/178 (22%) | ||
GH18_chitolectin_chitotriosidase | 1910..2274 | CDD:119351 | 40/177 (23%) | ||
chil-27 | NP_496035.1 | Glyco_hydro_18 | 89..>228 | CDD:279094 | 40/166 (24%) |
GH18_chitinase-like | 97..>235 | CDD:299167 | 38/158 (24%) | ||
Glyco_hydro_18 | 261..>402 | CDD:279094 | |||
GH18_chitinase-like | 268..>407 | CDD:299167 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |