DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and chil-27

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:207 Identity:49/207 - (23%)
Similarity:89/207 - (42%) Gaps:39/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1880 SNQRTQEPAVHRPNPTSVITEPPIINNSYKVVCYFTSWAWYRSSQGKFVPEDIDANLCTHLIY-- 1942
            :|.....||......:|.|  |||.|:.........:......|.|...|.|    ..|.:::  
 Worm    50 ANNAMGHPAKENDESSSEI--PPIENDIASTTQIIPTVPLLTDSSGSEKPPD----KVTFVLFAA 108

  Fly  1943 ------GFAVLDSKSLTIKTHDSWTDIDNRFYERVVEYKQRGLRVMLAIGGWNDSLGSKYARLVL 2001
                  |...:|..|.|.......:.|::..:::           :|:|||.::   :::..||:
 Worm   109 DRIGFDGSVEVDHSSRTFSKLKEKSKIESSHFKK-----------LLSIGGRSN---TQFLPLVI 159

  Fly  2002 -NSQSRRRFVASVISFLEQHGFEGLDLAWEFPVCWQVNCNRGNPTEK-DGFVALVKELSEAFKEN 2064
             :.:.:|||..|:||.||::..:|:||.|:    |..|.|    |:| ..|:..:|:..:..|:|
 Worm   160 ADPRRKRRFFKSIISILEEYQLDGVDLLWK----WAKNSN----TKKCSRFLCELKQKLKERKKN 216

  Fly  2065 GLILSAAVSPSK 2076
             .:||..:.|.:
 Worm   217 -YVLSVQILPDE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 40/178 (22%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 40/177 (23%)
chil-27NP_496035.1 Glyco_hydro_18 89..>228 CDD:279094 40/166 (24%)
GH18_chitinase-like 97..>235 CDD:299167 38/158 (24%)
Glyco_hydro_18 261..>402 CDD:279094
GH18_chitinase-like 268..>407 CDD:299167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.