DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and chil-12

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_506770.2 Gene:chil-12 / 187357 WormBaseID:WBGene00010799 Length:450 Species:Caenorhabditis elegans


Alignment Length:411 Identity:94/411 - (22%)
Similarity:170/411 - (41%) Gaps:103/411 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1902 PIINNSYKVVCYFTSWAWYRSSQGKFVPEDIDANLCTHLIYGF--AVLDSKSLTIK-----THDS 1959
            ||....|..:....:.:.|.|.:.||.|...:.|.|:..|.|:  ...||: :||.     ||..
 Worm    56 PITKAGYTPLSSPDASSIYNSFKNKFPPIKTEENTCSKRIIGYYSGTSDSE-ITINQVSKLTHAI 119

  Fly  1960 WTDID------------NRF--YERVVEYKQRGLRVMLAIGGWNDSLGSKYARLVLNSQSRRRFV 2010
            :..:.            |||  ...:.:.:...::.|.:|||...|  ..::.:|.|.:.:|||:
 Worm   120 FAFVQLTFDGTLVFRNKNRFMALRNIAKTENSTVKFMFSIGGPGHS--QNFSPVVRNQEKKRRFI 182

  Fly  2011 ASVISFLEQHGFEGLDLAWEFPVCWQVNCNRGNPTEKDGFVALVKELSEAFK-ENGLILSAAVSP 2074
            .|:.||||:|..:|:|:.|::|          :..:|..:...:.||:|..| ....|||..|.|
 Worm   183 KSIFSFLEEHKLDGVDIFWKWP----------HLADKHAYSQFLLELNEILKTRKDYILSILVPP 237

  Fly  2075 SKMVIDAGYNVFELSPYFDWVAVMTYDFHG----HWDMRTGQIAPLFHRGGDE-----NLYLNGN 2130
            ..:...:|:.:.|:....|::.:...|::|    .|...||.|:|::  ||.|     |:   .|
 Worm   238 QGIGFASGFKMNEIVENVDFINIFAMDYYGPWASGWGNPTGPISPIY--GGSERREQWNV---DN 297

  Fly  2131 FSIHYWLERGIPNDKLVMGMPMYGQTFTLADQNRRSLNDKTVG-----PGKAGTFTRADGFLAYY 2190
            .:..|..|. :.:.|..:.:|.:.:.:            ..||     |||              
 Worm   298 TAAIYSCET-MRSSKFNIVIPFFARLW------------NNVGKPIDFPGK-------------- 335

  Fly  2191 EICEKVVNDDWKVVRD---------EEGI-FGSYAY------------SGNQWISYDDVTTIRRK 2233
            |:...|...|.|.|.:         ::|. ..||.|            :..::::::...:|..|
 Worm   336 EVYRNVTLIDGKAVGEVYMPRRSALQKGYNLSSYNYDDLSETAFIYNSTTKEYLTFEVKRSIAAK 400

  Fly  2234 SQFIKSLQLGGGMIWALDLDD 2254
            ..:::::.|||..||.:|:||
 Worm   401 LDYVQNMNLGGVWIWQMDMDD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 89/401 (22%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 91/403 (23%)
chil-12NP_506770.2 Glyco_18 94..420 CDD:214753 82/370 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164220
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.