DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and chil-6

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_496126.1 Gene:chil-6 / 182436 WormBaseID:WBGene00007471 Length:460 Species:Caenorhabditis elegans


Alignment Length:355 Identity:90/355 - (25%)
Similarity:151/355 - (42%) Gaps:67/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 IIYSFASLDPDHLTIREFDS---WVDLDNQYYRRVTSLGVPVLIALGGWTDSSGSKYSRLVSDNL 312
            |||.||......||.|:..|   :|.:.|:  .|..|..:.|:|::||  ..|..::|.|||...
 Worm   137 IIYLFAIPKNGSLTFRDESSRRKFVAMKNE--ARKESSTLKVMISIGG--QYSSGEFSGLVSKET 197

  Fly   313 KRRVFISSVSSFLLRHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLLRELRTEFQSVDPK-- 375
            .|.:|.:|:.||:..:...|:.:.|.:||          .:|..|....:||||..|..:..|  
 Worm   198 SRNLFTNSIVSFVQNYDIDGVDIFWTWPK----------YSDENNYLMFIRELRYAFTELQKKLN 252

  Fly   376 ----FQLGVAISGYKEIIKEAYDFPALSDIVDYMTVMTYDYHGAWEQKTGHVSPLYGLSSDTYPQ 436
                |.:.:.||.....:....:|   |:.||::.:..::   ::..:.|..|||||..|....:
 Worm   253 RKETFVISLVISRNVNHLSNLVEF---SNFVDFLNIYLFN---SFLNQIGPDSPLYGGGSRIVDE 311

  Fly   437 YNTNYTMQLLLKMGARREKLVLSIPFYGQSFTLATAHQILAGPGVAASGPGDAGELTK--QPGML 499
             |..|   .:.|.| :..|..:.:.|:...:.           |.......|:.::.|  ..|.|
 Worm   312 -NMKY---YICKSG-QPSKFNIIVSFHATYWN-----------GAELPLRDDSDDIWKDNNSGRL 360

  Fly   500 AYYEICQRLTKFNW----ISDRNLNV-----IFGPFAMLNDQWVGYEDPTSAQAKARYAANNNFA 555
            ......::|.::||    |...||..     |.||    ..:::..|:..|.:.|.||.|::|..
 Worm   361 PIALPRRQLRQYNWNLTDIKFHNLTKTSYIWIPGP----PTRFMTLEEERSLREKNRYVADHNIG 421

  Fly   556 GVAAWTIDLDDFRNLCCNESYPLLRAINRA 585
            |:..||||.||       :.:.||:.::.|
 Worm   422 GITMWTIDQDD-------DDHTLLKVVSSA 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753 85/333 (26%)
GH18_chitolectin_chitotriosidase 221..586 CDD:119351 90/355 (25%)
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
chil-6NP_496126.1 Glyco_18 113..431 CDD:214753 85/333 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164201
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.