DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and chil-3

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_496128.1 Gene:chil-3 / 182432 WormBaseID:WBGene00007467 Length:447 Species:Caenorhabditis elegans


Alignment Length:404 Identity:96/404 - (23%)
Similarity:155/404 - (38%) Gaps:108/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 KKVLCYMSNWAFYRSG--EAHFVPEQIDPNLCSAIIYSFA-------SLDPDHLTIREFDSWVDL 274
            |:::.|.:.  |..||  ..|.       .:.:.|||.||       :||.:. |.|:|.     
 Worm    99 KRIVGYFAE--FENSGLTRRHL-------QMVTHIIYLFARPTNGVMTLDGER-TRRKFQ----- 148

  Fly   275 DNQYYRRVTSLGVPVLIALGGWTDSSGSKYSRLVSDNLKRRVFISSVSSFLLRHGFSGLHLDWNY 339
            :.:...|..|..|.|:|::|| .|.||: :|.::|:...|.|||.|:.||:......|:.:.|.:
 Worm   149 EMRSKAREVSSTVKVMISVGG-HDHSGA-FSAIMSNEASRSVFIKSIVSFVKNEDIDGIEIFWMW 211

  Fly   340 PKCWQSDCSRGPVTDRPNLTKLLRELRTEFQSVDPK--------FQLGVAISGYKEIIKEAYDFP 396
            ||          ..|..|.:..:::||.||..:..:        ..|.|....|     .::||.
 Worm   212 PK----------HRDVNNYSIFIQDLRNEFTELQKRTNRKNEYIISLLVPKKSY-----WSFDFE 261

  Fly   397 ALSDIVDYMTVMTYDYHGAWEQKTGHVSPLYGLSSDTYPQYNTNYTMQLLLKMGARREKLVLSIP 461
            .....||:..:.:..:.   |::.|..|||||...     .|.:.||:.......:..|..:.:.
 Worm   262 DFLKFVDFFNIYSTQFR---EKQVGPDSPLYGGEG-----RNIDETMKYYTCKTGQPSKFNIFVS 318

  Fly   462 FYGQSFTLATAHQILAGPGVAASGPGDA--------------GELTKQPGMLAYYEICQRLTKFN 512
            |:|..:.                   ||              ..|||....:.:.|:.|:.....
 Worm   319 FHGTFWK-------------------DAELPLRNDFDDIFKDKNLTKGAFAVRWRELLQQKWNLE 364

  Fly   513 WISDRNLNV-----IFGPFAMLNDQW-VGYEDPTSAQAKARYAANNNFAGVAAWTIDLDDFRNLC 571
            .|...||..     |.||     ..| :..||..|.:.|.:|.|:.|..|:..||||.||     
 Worm   365 DIKFHNLTKTSYIWIPGP-----PTWFMTLEDKRSLREKTKYVADYNIGGITMWTIDQDD----- 419

  Fly   572 CNESYPLLRAINRA 585
              :.:.||:.::.|
 Worm   420 --DDHTLLKVVSSA 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753 90/381 (24%)
GH18_chitolectin_chitotriosidase 221..586 CDD:119351 95/402 (24%)
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
chil-3NP_496128.1 Glyco_18 100..418 CDD:214753 90/381 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164205
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.