DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and CTBS

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS / 1486 HGNCID:2496 Length:385 Species:Homo sapiens


Alignment Length:418 Identity:96/418 - (22%)
Similarity:163/418 - (38%) Gaps:91/418 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   947 LRPTYPTEKPVPKPRDSHYKVICYFTNWAWYRKGIGRFTPDDINTELCT----HVIYGFAVLDYS 1007
            ||....|:.|.|:|                               |||.    |..:...|.|..
Human    33 LRLAAGTDCPCPEP-------------------------------ELCRPIRHHPDFEVFVFDVG 66

  Fly  1008 ELVLRTHDSWADVENNFYTRVTSL-----------KSKGIKVSLALGGWNDSQGDKYSRLVRSPM 1061
            :...:::| |:.:     |.|.:.           .|||.:|.|        :||...:.:..|.
Human    67 QKTWKSYD-WSQI-----TTVATFGKYDSELMCYAHSKGARVVL--------KGDVSLKDIIDPA 117

  Fly  1062 ARSRFVRHALEFIEKYGFEGLDLDWEYPVCWQTECNKGSTEEKDGFTAWVQELSEAFRP--RGLM 1124
            .|:.::...|...:....:|:::|.|..|    .|   .:.|.|..||.|:|.:::|..  .|..
Human   118 FRASWIAQKLNLAKTQYMDGINIDIEQEV----NC---LSPEYDALTALVKETTDSFHREIEGSQ 175

  Fly  1125 LSTAVSPSRKIIDAG-YDIPQLSRYFDWIAVMTYDFHGH-WDKKTGHVAPLYHHPDDDFEYFNVN 1187
            ::..|:.|.|.||.. |:...::...|::.||:||.... |.:........|:.....:..: :.
Human   176 VTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDY-IK 239

  Fly  1188 YSINYWMEKGAPSQKLVMGIPLYGQSFTLENTNSSGLNAKAPAPGEAGEFTRAAG-FLAYYEICE 1251
            .|||        .:|||||:|.||..:|..|.:...:...|..|......:.||| .:.|..|.:
Human   240 MSIN--------PKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMK 296

  Fly  1252 RVNRQGWQVVHDEFGRMGPYAYKGT----QWVSYDSPDMVRKKSLLVRSLKLGGGMVWALDLDDF 1312
            ::|......:.|:..|...|.||..    ..|.||:|..:..|:..:::.:|.|..:|..:..|:
Human   297 QINSSISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRGIGMWNANCLDY 361

  Fly  1313 KNRCGNGVHPLLT-EIHNVLKDPPSLME 1339
            .   |:.|....| |:..|||  |.|::
Human   362 S---GDAVAKQQTEEMWEVLK--PKLLQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 80/367 (22%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 85/388 (22%)
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 89/402 (22%)
Glyco_18 <115..358 CDD:214753 63/258 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8303
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.